PDB entry 1jze

View 1jze on RCSB PDB site
Description: Pseudomonas aeruginosa Azurin Ru(bpy)2(im)(His83)
Class: electron transport
Keywords: Blue-copper, Electron Transfer, Ruthenium, ELECTRON TRANSPORT
Deposited on 2001-09-16, released 2001-10-17
The last revision prior to the SCOPe 2.08 freeze date was dated 2011-11-02, with a file datestamp of 2011-10-28.
Experiment type: XRAY
Resolution: 1.6 Å
R-factor: 0.249
AEROSPACI score: 0.5 (click here for full SPACI score report)

Chains and heterogens:

• Chain 'A':
  Compound: Azurin
  Species: Pseudomonas aeruginosa [TaxId:287]
  Database cross-references and differences (RAF-indexed):
  • Uniprot P00282 (0-127)
  Domains in SCOPe 2.08: d1jzea_
• Heterogens: CU, DRU, LRU, HOH

PDB Chain Sequences:

• Chain 'A':
  Sequence; same for both SEQRES and ATOM records: (download)
  

  >1jzeA (A:)
  aecsvdiqgndqmqfntnaitvdksckqftvnlshpgnlpknvmghnwvlstaadmqgvv
  tdgmasgldkdylkpddsrviahtkligsgekdsvtfdvsklkegeqymffctfpghsal
  mkgtltlk