PDB entry 1jzd

View 1jzd on RCSB PDB site
Description: DsbC-DsbDalpha complex
Class: oxidoreductase
Keywords: thiol disulfide oxidoreductase, reaction intermediate, protein-protein complex
Deposited on 2001-09-15, released 2003-03-08
The last revision prior to the SCOPe 2.06 freeze date was dated 2009-02-24, with a file datestamp of 2009-02-03.
Experiment type: XRAY
Resolution: 2.3 Å
R-factor: 0.234
AEROSPACI score: 0.32 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: thiol:disulfide interchange protein dsbc
    Species: Escherichia coli [TaxId:562]
    Gene: dsbC
    Database cross-references and differences (RAF-indexed):
    • Uniprot P21892 (4-End)
      • expression tag (0-3)
      • engineered (104)
    Domains in SCOPe 2.06: d1jzda1, d1jzda2, d1jzda3
  • Chain 'B':
    Compound: thiol:disulfide interchange protein dsbc
    Species: Escherichia coli [TaxId:562]
    Gene: dsbC
    Database cross-references and differences (RAF-indexed):
    • Uniprot P21892 (4-End)
      • engineered (104)
    Domains in SCOPe 2.06: d1jzdb1, d1jzdb2
  • Chain 'C':
    Compound: Thiol:disulfide interchange protein dsbD
    Species: Escherichia coli [TaxId:562]
    Gene: dsbD
    Database cross-references and differences (RAF-indexed):
    • Uniprot P36655
      • engineered (102)
    Domains in SCOPe 2.06: d1jzdc_
  • Heterogens: HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >1jzdA (A:)
    gamaddaaiqqtlakmgikssdiqpapvagmktvltnsgvlyitddgkhiiqgpmydvsg
    tapvnvtnkmllkqlnalekemivykapqekhvitvftditcgyshklheqmadynalgi
    tvrylafprqgldsdaekemkaiwcakdknkafddvmagksvapascdvdiadhyalgvq
    lgvsgtpavvlsngtlvpgyqppkemkefldehqkmtsgk
    

    Sequence, based on observed residues (ATOM records): (download)
    >1jzdA (A:)
    gamaddaaiqqtlakmgikssdiqpapvagmktvltnsgvlyitddgkhiiqgpmydvsg
    tapvnvtnkmllkqlnalekemivykapqekhvitvftditcgyshklheqmadynalgi
    tvrylafprqgldsdaekemkaiwcakdknkafddvmagksvapascdvdiadhyalgvq
    lgvsgtpavvlsngtlvpgyqppkemkefldehqkmtsg
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >1jzdB (B:)
    gamaddaaiqqtlakmgikssdiqpapvagmktvltnsgvlyitddgkhiiqgpmydvsg
    tapvnvtnkmllkqlnalekemivykapqekhvitvftditcgyshklheqmadynalgi
    tvrylafprqgldsdaekemkaiwcakdknkafddvmagksvapascdvdiadhyalgvq
    lgvsgtpavvlsngtlvpgyqppkemkefldehqkmtsgk
    

    Sequence, based on observed residues (ATOM records): (download)
    >1jzdB (B:)
    ddaaiqqtlakmgikssdiqpapvagmktvltnsgvlyitddgkhiiqgpmydvsgtapv
    nvtnkmllkqlnalekemivykapqekhvitvftditcgyshklheqmadynalgitvry
    lafprqgldsdaekemkaiwcakdknkafddvmagksvapascdvdiadhyalgvqlgvs
    gtpavvlsngtlvpgyqppkemkefldehqkmts
    

  • Chain 'C':
    Sequence, based on SEQRES records: (download)
    >1jzdC (C:)
    glfdapgrsqfvpadqafafdfqqnqhdlnltwqikdgyylyrkqiritpehakiadvql
    pqgvwhedefygkseiyrdrltlpvtinqasagatltvtyqgaadagfcyppetktvpls
    evvannaapqpv
    

    Sequence, based on observed residues (ATOM records): (download)
    >1jzdC (C:)
    rsqfvpadqafafdfqqnqhdlnltwqikdgyylyrkqiritpehakiadvqlpqgvwhe
    defygkseiyrdrltlpvtinqasagatltvtyqgaadagfcyppetktvplsevvan