PDB entry 1jz7

View 1jz7 on RCSB PDB site
Description: E. COLI (lacZ) BETA-GALACTOSIDASE IN COMPLEX WITH GALACTOSE
Class: hydrolase
Keywords: tim barrel (alpha/beta barrel), jelly-roll barrel, immunoglobulin, beta supersandwich, hydrolase
Deposited on 2001-09-13, released 2001-12-07
The last revision prior to the SCOPe 2.06 freeze date was dated 2009-09-15, with a file datestamp of 2009-09-11.
Experiment type: XRAY
Resolution: 1.5 Å
R-factor: 0.176
AEROSPACI score: 0.61 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: beta-galactosidase
    Species: Escherichia coli [TaxId:562]
    Gene: lacZ
    Database cross-references and differences (RAF-indexed):
    • Uniprot P00722 (Start-1022)
      • modified residue (246)
    Domains in SCOPe 2.06: d1jz7a1, d1jz7a2, d1jz7a3, d1jz7a4, d1jz7a5
  • Chain 'B':
    Compound: beta-galactosidase
    Species: Escherichia coli [TaxId:562]
    Gene: lacZ
    Database cross-references and differences (RAF-indexed):
    • Uniprot P00722 (Start-1022)
      • modified residue (246)
    Domains in SCOPe 2.06: d1jz7b1, d1jz7b2, d1jz7b3, d1jz7b4, d1jz7b5
  • Chain 'C':
    Compound: beta-galactosidase
    Species: Escherichia coli [TaxId:562]
    Gene: lacZ
    Database cross-references and differences (RAF-indexed):
    • Uniprot P00722 (Start-1022)
      • modified residue (246)
    Domains in SCOPe 2.06: d1jz7c1, d1jz7c2, d1jz7c3, d1jz7c4, d1jz7c5
  • Chain 'D':
    Compound: beta-galactosidase
    Species: Escherichia coli [TaxId:562]
    Gene: lacZ
    Database cross-references and differences (RAF-indexed):
    • Uniprot P00722 (Start-1022)
      • modified residue (246)
    Domains in SCOPe 2.06: d1jz7d1, d1jz7d2, d1jz7d3, d1jz7d4, d1jz7d5
  • Heterogens: GAL, MG, NA, DMS, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >1jz7A (A:)
    gshmledpvvlqrrdwenpgvtqlnrlaahppfaswrnseeartdrpsqqlrslngewrf
    awfpapeavpeswlecdlpeadtvvvpsnwqmhgydapiytnvtypitvnppfvptenpt
    gcysltfnvdeswlqegqtriifdgvnsafhlwcngrwvgygqdsrlpsefdlsaflrag
    enrlavmvlrwsdgsyledqdmwrmsgifrdvsllhkpttqisdfhvatrfnddfsravl
    eaevqmcgelrdylrvtvslwqgetqvasgtapfggeiiderggyadrvtlrlnvenpkl
    wsaeipnlyravvelhtadgtlieaeacdvgfrevriengllllngkpllirgvnrhehh
    plhgqvmdeqtmvqdillmkqnnfnavrcshypnhplwytlcdryglyvvdeaniethgm
    vpmnrltddprwlpamservtrmvqrdrnhpsviiwslgnesghganhdalyrwiksvdp
    srpvqyegggadttatdiicpmyarvdedqpfpavpkwsikkwlslpgetrplilceyah
    amgnslggfakywqafrqyprlqggfvwdwvdqslikydengnpwsayggdfgdtpndrq
    fcmnglvfadrtphpalteakhqqqffqfrlsgqtievtseylfrhsdnellhwmvaldg
    kplasgevpldvapqgkqlielpelpqpesagqlwltvrvvqpnatawseaghisawqqw
    rlaenlsvtlpaashaiphlttsemdfcielgnkrwqfnrqsgflsqmwigdkkqlltpl
    rdqftrapldndigvseatridpnawverwkaaghyqaeaallqctadtladavlittah
    awqhqgktlfisrktyridgsgqmaitvdvevasdtphpariglncqlaqvaervnwlgl
    gpqenypdrltaacfdrwdlplsdmytpyvfpsenglrcgtrelnygphqwrgdfqfnis
    rysqqqlmetshrhllhaeegtwlnidgfhmgiggddswspsvsaefqlsagryhyqlvw
    cqk
    

    Sequence, based on observed residues (ATOM records): (download)
    >1jz7A (A:)
    rrdwenpgvtqlnrlaahppfaswrnseeartdrpsqqlrslngewrfawfpapeavpes
    wlecdlpeadtvvvpsnwqmhgydapiytnvtypitvnppfvptenptgcysltfnvdes
    wlqegqtriifdgvnsafhlwcngrwvgygqdsrlpsefdlsaflragenrlavmvlrws
    dgsyledqdmwrmsgifrdvsllhkpttqisdfhvatrfnddfsravleaevqmcgelrd
    ylrvtvslwqgetqvasgtapfggeiiderggyadrvtlrlnvenpklwsaeipnlyrav
    velhtadgtlieaeacdvgfrevriengllllngkpllirgvnrhehhplhgqvmdeqtm
    vqdillmkqnnfnavrcshypnhplwytlcdryglyvvdeaniethgmvpmnrltddprw
    lpamservtrmvqrdrnhpsviiwslgnesghganhdalyrwiksvdpsrpvqyegggad
    ttatdiicpmyarvdedqpfpavpkwsikkwlslpgetrplilceyahamgnslggfaky
    wqafrqyprlqggfvwdwvdqslikydengnpwsayggdfgdtpndrqfcmnglvfadrt
    phpalteakhqqqffqfrlsgqtievtseylfrhsdnellhwmvaldgkplasgevpldv
    apqgkqlielpelpqpesagqlwltvrvvqpnatawseaghisawqqwrlaenlsvtlpa
    ashaiphlttsemdfcielgnkrwqfnrqsgflsqmwigdkkqlltplrdqftrapldnd
    igvseatridpnawverwkaaghyqaeaallqctadtladavlittahawqhqgktlfis
    rktyridgsgqmaitvdvevasdtphpariglncqlaqvaervnwlglgpqenypdrlta
    acfdrwdlplsdmytpyvfpsenglrcgtrelnygphqwrgdfqfnisrysqqqlmetsh
    rhllhaeegtwlnidgfhmgiggddswspsvsaefqlsagryhyqlvwcqk
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >1jz7B (B:)
    gshmledpvvlqrrdwenpgvtqlnrlaahppfaswrnseeartdrpsqqlrslngewrf
    awfpapeavpeswlecdlpeadtvvvpsnwqmhgydapiytnvtypitvnppfvptenpt
    gcysltfnvdeswlqegqtriifdgvnsafhlwcngrwvgygqdsrlpsefdlsaflrag
    enrlavmvlrwsdgsyledqdmwrmsgifrdvsllhkpttqisdfhvatrfnddfsravl
    eaevqmcgelrdylrvtvslwqgetqvasgtapfggeiiderggyadrvtlrlnvenpkl
    wsaeipnlyravvelhtadgtlieaeacdvgfrevriengllllngkpllirgvnrhehh
    plhgqvmdeqtmvqdillmkqnnfnavrcshypnhplwytlcdryglyvvdeaniethgm
    vpmnrltddprwlpamservtrmvqrdrnhpsviiwslgnesghganhdalyrwiksvdp
    srpvqyegggadttatdiicpmyarvdedqpfpavpkwsikkwlslpgetrplilceyah
    amgnslggfakywqafrqyprlqggfvwdwvdqslikydengnpwsayggdfgdtpndrq
    fcmnglvfadrtphpalteakhqqqffqfrlsgqtievtseylfrhsdnellhwmvaldg
    kplasgevpldvapqgkqlielpelpqpesagqlwltvrvvqpnatawseaghisawqqw
    rlaenlsvtlpaashaiphlttsemdfcielgnkrwqfnrqsgflsqmwigdkkqlltpl
    rdqftrapldndigvseatridpnawverwkaaghyqaeaallqctadtladavlittah
    awqhqgktlfisrktyridgsgqmaitvdvevasdtphpariglncqlaqvaervnwlgl
    gpqenypdrltaacfdrwdlplsdmytpyvfpsenglrcgtrelnygphqwrgdfqfnis
    rysqqqlmetshrhllhaeegtwlnidgfhmgiggddswspsvsaefqlsagryhyqlvw
    cqk
    

    Sequence, based on observed residues (ATOM records): (download)
    >1jz7B (B:)
    rrdwenpgvtqlnrlaahppfaswrnseeartdrpsqqlrslngewrfawfpapeavpes
    wlecdlpeadtvvvpsnwqmhgydapiytnvtypitvnppfvptenptgcysltfnvdes
    wlqegqtriifdgvnsafhlwcngrwvgygqdsrlpsefdlsaflragenrlavmvlrws
    dgsyledqdmwrmsgifrdvsllhkpttqisdfhvatrfnddfsravleaevqmcgelrd
    ylrvtvslwqgetqvasgtapfggeiiderggyadrvtlrlnvenpklwsaeipnlyrav
    velhtadgtlieaeacdvgfrevriengllllngkpllirgvnrhehhplhgqvmdeqtm
    vqdillmkqnnfnavrcshypnhplwytlcdryglyvvdeaniethgmvpmnrltddprw
    lpamservtrmvqrdrnhpsviiwslgnesghganhdalyrwiksvdpsrpvqyegggad
    ttatdiicpmyarvdedqpfpavpkwsikkwlslpgetrplilceyahamgnslggfaky
    wqafrqyprlqggfvwdwvdqslikydengnpwsayggdfgdtpndrqfcmnglvfadrt
    phpalteakhqqqffqfrlsgqtievtseylfrhsdnellhwmvaldgkplasgevpldv
    apqgkqlielpelpqpesagqlwltvrvvqpnatawseaghisawqqwrlaenlsvtlpa
    ashaiphlttsemdfcielgnkrwqfnrqsgflsqmwigdkkqlltplrdqftrapldnd
    igvseatridpnawverwkaaghyqaeaallqctadtladavlittahawqhqgktlfis
    rktyridgsgqmaitvdvevasdtphpariglncqlaqvaervnwlglgpqenypdrlta
    acfdrwdlplsdmytpyvfpsenglrcgtrelnygphqwrgdfqfnisrysqqqlmetsh
    rhllhaeegtwlnidgfhmgiggddswspsvsaefqlsagryhyqlvwcqk
    

  • Chain 'C':
    Sequence, based on SEQRES records: (download)
    >1jz7C (C:)
    gshmledpvvlqrrdwenpgvtqlnrlaahppfaswrnseeartdrpsqqlrslngewrf
    awfpapeavpeswlecdlpeadtvvvpsnwqmhgydapiytnvtypitvnppfvptenpt
    gcysltfnvdeswlqegqtriifdgvnsafhlwcngrwvgygqdsrlpsefdlsaflrag
    enrlavmvlrwsdgsyledqdmwrmsgifrdvsllhkpttqisdfhvatrfnddfsravl
    eaevqmcgelrdylrvtvslwqgetqvasgtapfggeiiderggyadrvtlrlnvenpkl
    wsaeipnlyravvelhtadgtlieaeacdvgfrevriengllllngkpllirgvnrhehh
    plhgqvmdeqtmvqdillmkqnnfnavrcshypnhplwytlcdryglyvvdeaniethgm
    vpmnrltddprwlpamservtrmvqrdrnhpsviiwslgnesghganhdalyrwiksvdp
    srpvqyegggadttatdiicpmyarvdedqpfpavpkwsikkwlslpgetrplilceyah
    amgnslggfakywqafrqyprlqggfvwdwvdqslikydengnpwsayggdfgdtpndrq
    fcmnglvfadrtphpalteakhqqqffqfrlsgqtievtseylfrhsdnellhwmvaldg
    kplasgevpldvapqgkqlielpelpqpesagqlwltvrvvqpnatawseaghisawqqw
    rlaenlsvtlpaashaiphlttsemdfcielgnkrwqfnrqsgflsqmwigdkkqlltpl
    rdqftrapldndigvseatridpnawverwkaaghyqaeaallqctadtladavlittah
    awqhqgktlfisrktyridgsgqmaitvdvevasdtphpariglncqlaqvaervnwlgl
    gpqenypdrltaacfdrwdlplsdmytpyvfpsenglrcgtrelnygphqwrgdfqfnis
    rysqqqlmetshrhllhaeegtwlnidgfhmgiggddswspsvsaefqlsagryhyqlvw
    cqk
    

    Sequence, based on observed residues (ATOM records): (download)
    >1jz7C (C:)
    rrdwenpgvtqlnrlaahppfaswrnseeartdrpsqqlrslngewrfawfpapeavpes
    wlecdlpeadtvvvpsnwqmhgydapiytnvtypitvnppfvptenptgcysltfnvdes
    wlqegqtriifdgvnsafhlwcngrwvgygqdsrlpsefdlsaflragenrlavmvlrws
    dgsyledqdmwrmsgifrdvsllhkpttqisdfhvatrfnddfsravleaevqmcgelrd
    ylrvtvslwqgetqvasgtapfggeiiderggyadrvtlrlnvenpklwsaeipnlyrav
    velhtadgtlieaeacdvgfrevriengllllngkpllirgvnrhehhplhgqvmdeqtm
    vqdillmkqnnfnavrcshypnhplwytlcdryglyvvdeaniethgmvpmnrltddprw
    lpamservtrmvqrdrnhpsviiwslgnesghganhdalyrwiksvdpsrpvqyegggad
    ttatdiicpmyarvdedqpfpavpkwsikkwlslpgetrplilceyahamgnslggfaky
    wqafrqyprlqggfvwdwvdqslikydengnpwsayggdfgdtpndrqfcmnglvfadrt
    phpalteakhqqqffqfrlsgqtievtseylfrhsdnellhwmvaldgkplasgevpldv
    apqgkqlielpelpqpesagqlwltvrvvqpnatawseaghisawqqwrlaenlsvtlpa
    ashaiphlttsemdfcielgnkrwqfnrqsgflsqmwigdkkqlltplrdqftrapldnd
    igvseatridpnawverwkaaghyqaeaallqctadtladavlittahawqhqgktlfis
    rktyridgsgqmaitvdvevasdtphpariglncqlaqvaervnwlglgpqenypdrlta
    acfdrwdlplsdmytpyvfpsenglrcgtrelnygphqwrgdfqfnisrysqqqlmetsh
    rhllhaeegtwlnidgfhmgiggddswspsvsaefqlsagryhyqlvwcqk
    

  • Chain 'D':
    Sequence, based on SEQRES records: (download)
    >1jz7D (D:)
    gshmledpvvlqrrdwenpgvtqlnrlaahppfaswrnseeartdrpsqqlrslngewrf
    awfpapeavpeswlecdlpeadtvvvpsnwqmhgydapiytnvtypitvnppfvptenpt
    gcysltfnvdeswlqegqtriifdgvnsafhlwcngrwvgygqdsrlpsefdlsaflrag
    enrlavmvlrwsdgsyledqdmwrmsgifrdvsllhkpttqisdfhvatrfnddfsravl
    eaevqmcgelrdylrvtvslwqgetqvasgtapfggeiiderggyadrvtlrlnvenpkl
    wsaeipnlyravvelhtadgtlieaeacdvgfrevriengllllngkpllirgvnrhehh
    plhgqvmdeqtmvqdillmkqnnfnavrcshypnhplwytlcdryglyvvdeaniethgm
    vpmnrltddprwlpamservtrmvqrdrnhpsviiwslgnesghganhdalyrwiksvdp
    srpvqyegggadttatdiicpmyarvdedqpfpavpkwsikkwlslpgetrplilceyah
    amgnslggfakywqafrqyprlqggfvwdwvdqslikydengnpwsayggdfgdtpndrq
    fcmnglvfadrtphpalteakhqqqffqfrlsgqtievtseylfrhsdnellhwmvaldg
    kplasgevpldvapqgkqlielpelpqpesagqlwltvrvvqpnatawseaghisawqqw
    rlaenlsvtlpaashaiphlttsemdfcielgnkrwqfnrqsgflsqmwigdkkqlltpl
    rdqftrapldndigvseatridpnawverwkaaghyqaeaallqctadtladavlittah
    awqhqgktlfisrktyridgsgqmaitvdvevasdtphpariglncqlaqvaervnwlgl
    gpqenypdrltaacfdrwdlplsdmytpyvfpsenglrcgtrelnygphqwrgdfqfnis
    rysqqqlmetshrhllhaeegtwlnidgfhmgiggddswspsvsaefqlsagryhyqlvw
    cqk
    

    Sequence, based on observed residues (ATOM records): (download)
    >1jz7D (D:)
    rrdwenpgvtqlnrlaahppfaswrnseeartdrpsqqlrslngewrfawfpapeavpes
    wlecdlpeadtvvvpsnwqmhgydapiytnvtypitvnppfvptenptgcysltfnvdes
    wlqegqtriifdgvnsafhlwcngrwvgygqdsrlpsefdlsaflragenrlavmvlrws
    dgsyledqdmwrmsgifrdvsllhkpttqisdfhvatrfnddfsravleaevqmcgelrd
    ylrvtvslwqgetqvasgtapfggeiiderggyadrvtlrlnvenpklwsaeipnlyrav
    velhtadgtlieaeacdvgfrevriengllllngkpllirgvnrhehhplhgqvmdeqtm
    vqdillmkqnnfnavrcshypnhplwytlcdryglyvvdeaniethgmvpmnrltddprw
    lpamservtrmvqrdrnhpsviiwslgnesghganhdalyrwiksvdpsrpvqyegggad
    ttatdiicpmyarvdedqpfpavpkwsikkwlslpgetrplilceyahamgnslggfaky
    wqafrqyprlqggfvwdwvdqslikydengnpwsayggdfgdtpndrqfcmnglvfadrt
    phpalteakhqqqffqfrlsgqtievtseylfrhsdnellhwmvaldgkplasgevpldv
    apqgkqlielpelpqpesagqlwltvrvvqpnatawseaghisawqqwrlaenlsvtlpa
    ashaiphlttsemdfcielgnkrwqfnrqsgflsqmwigdkkqlltplrdqftrapldnd
    igvseatridpnawverwkaaghyqaeaallqctadtladavlittahawqhqgktlfis
    rktyridgsgqmaitvdvevasdtphpariglncqlaqvaervnwlglgpqenypdrlta
    acfdrwdlplsdmytpyvfpsenglrcgtrelnygphqwrgdfqfnisrysqqqlmetsh
    rhllhaeegtwlnidgfhmgiggddswspsvsaefqlsagryhyqlvwcqk