PDB entry 1jz1

View 1jz1 on RCSB PDB site
Description: E. COLI (lacZ) BETA-GALACTOSIDASE-TRAPPED 2-F-GALACTOSYL-ENZYME INTERMEDIATE. Chains I-P, see REMARK 400
Class: hydrolase
Keywords: tim barrel (alpha/beta barrel), jelly-roll barrel, immunoglobulin, beta supersandwich, hydrolase
Deposited on 2001-09-13, released 2001-12-07
The last revision prior to the SCOPe 2.06 freeze date was dated 2014-12-10, with a file datestamp of 2014-12-05.
Experiment type: XRAY
Resolution: 2.6 Å
R-factor: 0.23
AEROSPACI score: 0.19 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'I':
    Compound: beta-galactosidase
    Species: Escherichia coli [TaxId:562]
    Gene: lacZ
    Database cross-references and differences (RAF-indexed):
    • Uniprot P00722 (Start-1022)
      • modified residue (747)
      • modified residue (913)
      • modified residue (1020)
    Domains in SCOPe 2.06: d1jz1i1, d1jz1i2, d1jz1i3, d1jz1i4, d1jz1i5
  • Chain 'J':
    Compound: beta-galactosidase
    Species: Escherichia coli [TaxId:562]
    Gene: lacZ
    Database cross-references and differences (RAF-indexed):
    • Uniprot P00722 (Start-1022)
      • modified residue (747)
      • modified residue (913)
      • modified residue (1020)
    Domains in SCOPe 2.06: d1jz1j1, d1jz1j2, d1jz1j3, d1jz1j4, d1jz1j5
  • Chain 'K':
    Compound: beta-galactosidase
    Species: Escherichia coli [TaxId:562]
    Gene: lacZ
    Database cross-references and differences (RAF-indexed):
    • Uniprot P00722 (Start-1022)
      • modified residue (747)
      • modified residue (913)
      • modified residue (1020)
    Domains in SCOPe 2.06: d1jz1k1, d1jz1k2, d1jz1k3, d1jz1k4, d1jz1k5
  • Chain 'L':
    Compound: beta-galactosidase
    Species: Escherichia coli [TaxId:562]
    Gene: lacZ
    Database cross-references and differences (RAF-indexed):
    • Uniprot P00722 (Start-1022)
      • modified residue (747)
      • modified residue (913)
      • modified residue (1020)
    Domains in SCOPe 2.06: d1jz1l1, d1jz1l2, d1jz1l3, d1jz1l4, d1jz1l5
  • Chain 'M':
    Compound: beta-galactosidase
    Species: Escherichia coli [TaxId:562]
    Gene: lacZ
    Database cross-references and differences (RAF-indexed):
    • Uniprot P00722 (Start-1022)
      • modified residue (747)
      • modified residue (913)
      • modified residue (1020)
    Domains in SCOPe 2.06: d1jz1m1, d1jz1m2, d1jz1m3, d1jz1m4, d1jz1m5
  • Chain 'N':
    Compound: beta-galactosidase
    Species: Escherichia coli [TaxId:562]
    Gene: lacZ
    Database cross-references and differences (RAF-indexed):
    • Uniprot P00722 (Start-1022)
      • modified residue (747)
      • modified residue (913)
      • modified residue (1020)
    Domains in SCOPe 2.06: d1jz1n1, d1jz1n2, d1jz1n3, d1jz1n4, d1jz1n5
  • Chain 'O':
    Compound: beta-galactosidase
    Species: Escherichia coli [TaxId:562]
    Gene: lacZ
    Database cross-references and differences (RAF-indexed):
    • Uniprot P00722 (Start-1022)
      • modified residue (747)
      • modified residue (913)
      • modified residue (1020)
    Domains in SCOPe 2.06: d1jz1o1, d1jz1o2, d1jz1o3, d1jz1o4, d1jz1o5
  • Chain 'P':
    Compound: beta-galactosidase
    Species: Escherichia coli [TaxId:562]
    Gene: lacZ
    Database cross-references and differences (RAF-indexed):
    • Uniprot P00722 (Start-1022)
      • modified residue (747)
      • modified residue (913)
      • modified residue (1020)
    Domains in SCOPe 2.06: d1jz1p1, d1jz1p2, d1jz1p3, d1jz1p4, d1jz1p5
  • Heterogens: 2FG, MG, NA, HOH

PDB Chain Sequences:

  • Chain 'I':
    Sequence, based on SEQRES records: (download)
    >1jz1I (I:)
    tmitdslavvlqrrdwenpgvtqlnrlaahppfaswrnseeartdrpsqqlrslngewrf
    awfpapeavpeswlecdlpeadtvvvpsnwqmhgydapiytnvtypitvnppfvptenpt
    gcysltfnvdeswlqegqtriifdgvnsafhlwcngrwvgygqdsrlpsefdlsaflrag
    enrlavmvlrwsdgsyledqdmwrmsgifrdvsllhkpttqisdfhvatrfnddfsravl
    eaevqmcgelrdylrvtvslwqgetqvasgtapfggeiiderggyadrvtlrlnvenpkl
    wsaeipnlyravvelhtadgtlieaeacdvgfrevriengllllngkpllirgvnrhehh
    plhgqvmdeqtmvqdillmkqnnfnavrcshypnhplwytlcdryglyvvdeaniethgm
    vpmnrltddprwlpamservtrmvqrdrnhpsviiwslgnesghganhdalyrwiksvdp
    srpvqyegggadttatdiicpmyarvdedqpfpavpkwsikkwlslpgetrplilceyah
    amgnslggfakywqafrqyprlqggfvwdwvdqslikydengnpwsayggdfgdtpndrq
    fcmnglvfadrtphpalteakhqqqffqfrlsgqtievtseylfrhsdnellhwmvaldg
    kplasgevpldvapqgkqlielpelpqpesagqlwltvrvvqpnatawseaghisawqqw
    rlaenlsvtlpaashaiphlttsemdfcielgnkrwqfnrqsgflsqmwigdkkqlltpl
    rdqftrapldndigvseatridpnawverwkaaghyqaeaallqctadtladavlittah
    awqhqgktlfisrktyridgsgqmaitvdvevasdtphpariglncqlaqvaervnwlgl
    gpqenypdrltaacfdrwdlplsdmytpyvfpsenglrcgtrelnygphqwrgdfqfnis
    rysqqqlmetshrhllhaeegtwlnidgfhmgiggddswspsvsaefqlsagryhyqlvw
    cqk
    

    Sequence, based on observed residues (ATOM records): (download)
    >1jz1I (I:)
    itdslavvlqrrdwenpgvtqlnrlaahppfaswrnseeartdrpsqqlrslngewrfaw
    fpapeavpeswlecdlpeadtvvvpsnwqmhgydapiytnvtypitvnppfvptenptgc
    ysltfnvdeswlqegqtriifdgvnsafhlwcngrwvgygqdsrlpsefdlsaflragen
    rlavmvlrwsdgsyledqdmwrmsgifrdvsllhkpttqisdfhvatrfnddfsravlea
    evqmcgelrdylrvtvslwqgetqvasgtapfggeiiderggyadrvtlrlnvenpklws
    aeipnlyravvelhtadgtlieaeacdvgfrevriengllllngkpllirgvnrhehhpl
    hgqvmdeqtmvqdillmkqnnfnavrcshypnhplwytlcdryglyvvdeaniethgmvp
    mnrltddprwlpamservtrmvqrdrnhpsviiwslgnesghganhdalyrwiksvdpsr
    pvqyegggadttatdiicpmyarvdedqpfpavpkwsikkwlslpgetrplilceyaham
    gnslggfakywqafrqyprlqggfvwdwvdqslikydengnpwsayggdfgdtpndrqfc
    mnglvfadrtphpalteakhqqqffqfrlsgqtievtseylfrhsdnellhwmvaldgkp
    lasgevpldvapqgkqlielpelpqpesagqlwltvrvvqpnatawseaghisawqqwrl
    aenlsvtlpaashaiphlttsemdfcielgnkrwqfnrqsgflsqmwigdkkqlltplrd
    qftrapldndigvseatridpnawverwkaaghyqaeaallqctadtladavlittahaw
    qhqgktlfisrktyridgsgqmaitvdvevasdtphpariglncqlaqvaervnwlglgp
    qenypdrltaacfdrwdlplsdmytpyvfpsenglrcgtrelnygphqwrgdfqfnisry
    sqqqlmetshrhllhaeegtwlnidgfhmgiggddswspsvsaefqlsagryhyqlvwcq
    k
    

  • Chain 'J':
    Sequence, based on SEQRES records: (download)
    >1jz1J (J:)
    tmitdslavvlqrrdwenpgvtqlnrlaahppfaswrnseeartdrpsqqlrslngewrf
    awfpapeavpeswlecdlpeadtvvvpsnwqmhgydapiytnvtypitvnppfvptenpt
    gcysltfnvdeswlqegqtriifdgvnsafhlwcngrwvgygqdsrlpsefdlsaflrag
    enrlavmvlrwsdgsyledqdmwrmsgifrdvsllhkpttqisdfhvatrfnddfsravl
    eaevqmcgelrdylrvtvslwqgetqvasgtapfggeiiderggyadrvtlrlnvenpkl
    wsaeipnlyravvelhtadgtlieaeacdvgfrevriengllllngkpllirgvnrhehh
    plhgqvmdeqtmvqdillmkqnnfnavrcshypnhplwytlcdryglyvvdeaniethgm
    vpmnrltddprwlpamservtrmvqrdrnhpsviiwslgnesghganhdalyrwiksvdp
    srpvqyegggadttatdiicpmyarvdedqpfpavpkwsikkwlslpgetrplilceyah
    amgnslggfakywqafrqyprlqggfvwdwvdqslikydengnpwsayggdfgdtpndrq
    fcmnglvfadrtphpalteakhqqqffqfrlsgqtievtseylfrhsdnellhwmvaldg
    kplasgevpldvapqgkqlielpelpqpesagqlwltvrvvqpnatawseaghisawqqw
    rlaenlsvtlpaashaiphlttsemdfcielgnkrwqfnrqsgflsqmwigdkkqlltpl
    rdqftrapldndigvseatridpnawverwkaaghyqaeaallqctadtladavlittah
    awqhqgktlfisrktyridgsgqmaitvdvevasdtphpariglncqlaqvaervnwlgl
    gpqenypdrltaacfdrwdlplsdmytpyvfpsenglrcgtrelnygphqwrgdfqfnis
    rysqqqlmetshrhllhaeegtwlnidgfhmgiggddswspsvsaefqlsagryhyqlvw
    cqk
    

    Sequence, based on observed residues (ATOM records): (download)
    >1jz1J (J:)
    itdslavvlqrrdwenpgvtqlnrlaahppfaswrnseeartdrpsqqlrslngewrfaw
    fpapeavpeswlecdlpeadtvvvpsnwqmhgydapiytnvtypitvnppfvptenptgc
    ysltfnvdeswlqegqtriifdgvnsafhlwcngrwvgygqdsrlpsefdlsaflragen
    rlavmvlrwsdgsyledqdmwrmsgifrdvsllhkpttqisdfhvatrfnddfsravlea
    evqmcgelrdylrvtvslwqgetqvasgtapfggeiiderggyadrvtlrlnvenpklws
    aeipnlyravvelhtadgtlieaeacdvgfrevriengllllngkpllirgvnrhehhpl
    hgqvmdeqtmvqdillmkqnnfnavrcshypnhplwytlcdryglyvvdeaniethgmvp
    mnrltddprwlpamservtrmvqrdrnhpsviiwslgnesghganhdalyrwiksvdpsr
    pvqyegggadttatdiicpmyarvdedqpfpavpkwsikkwlslpgetrplilceyaham
    gnslggfakywqafrqyprlqggfvwdwvdqslikydengnpwsayggdfgdtpndrqfc
    mnglvfadrtphpalteakhqqqffqfrlsgqtievtseylfrhsdnellhwmvaldgkp
    lasgevpldvapqgkqlielpelpqpesagqlwltvrvvqpnatawseaghisawqqwrl
    aenlsvtlpaashaiphlttsemdfcielgnkrwqfnrqsgflsqmwigdkkqlltplrd
    qftrapldndigvseatridpnawverwkaaghyqaeaallqctadtladavlittahaw
    qhqgktlfisrktyridgsgqmaitvdvevasdtphpariglncqlaqvaervnwlglgp
    qenypdrltaacfdrwdlplsdmytpyvfpsenglrcgtrelnygphqwrgdfqfnisry
    sqqqlmetshrhllhaeegtwlnidgfhmgiggddswspsvsaefqlsagryhyqlvwcq
    k
    

  • Chain 'K':
    Sequence, based on SEQRES records: (download)
    >1jz1K (K:)
    tmitdslavvlqrrdwenpgvtqlnrlaahppfaswrnseeartdrpsqqlrslngewrf
    awfpapeavpeswlecdlpeadtvvvpsnwqmhgydapiytnvtypitvnppfvptenpt
    gcysltfnvdeswlqegqtriifdgvnsafhlwcngrwvgygqdsrlpsefdlsaflrag
    enrlavmvlrwsdgsyledqdmwrmsgifrdvsllhkpttqisdfhvatrfnddfsravl
    eaevqmcgelrdylrvtvslwqgetqvasgtapfggeiiderggyadrvtlrlnvenpkl
    wsaeipnlyravvelhtadgtlieaeacdvgfrevriengllllngkpllirgvnrhehh
    plhgqvmdeqtmvqdillmkqnnfnavrcshypnhplwytlcdryglyvvdeaniethgm
    vpmnrltddprwlpamservtrmvqrdrnhpsviiwslgnesghganhdalyrwiksvdp
    srpvqyegggadttatdiicpmyarvdedqpfpavpkwsikkwlslpgetrplilceyah
    amgnslggfakywqafrqyprlqggfvwdwvdqslikydengnpwsayggdfgdtpndrq
    fcmnglvfadrtphpalteakhqqqffqfrlsgqtievtseylfrhsdnellhwmvaldg
    kplasgevpldvapqgkqlielpelpqpesagqlwltvrvvqpnatawseaghisawqqw
    rlaenlsvtlpaashaiphlttsemdfcielgnkrwqfnrqsgflsqmwigdkkqlltpl
    rdqftrapldndigvseatridpnawverwkaaghyqaeaallqctadtladavlittah
    awqhqgktlfisrktyridgsgqmaitvdvevasdtphpariglncqlaqvaervnwlgl
    gpqenypdrltaacfdrwdlplsdmytpyvfpsenglrcgtrelnygphqwrgdfqfnis
    rysqqqlmetshrhllhaeegtwlnidgfhmgiggddswspsvsaefqlsagryhyqlvw
    cqk
    

    Sequence, based on observed residues (ATOM records): (download)
    >1jz1K (K:)
    itdslavvlqrrdwenpgvtqlnrlaahppfaswrnseeartdrpsqqlrslngewrfaw
    fpapeavpeswlecdlpeadtvvvpsnwqmhgydapiytnvtypitvnppfvptenptgc
    ysltfnvdeswlqegqtriifdgvnsafhlwcngrwvgygqdsrlpsefdlsaflragen
    rlavmvlrwsdgsyledqdmwrmsgifrdvsllhkpttqisdfhvatrfnddfsravlea
    evqmcgelrdylrvtvslwqgetqvasgtapfggeiiderggyadrvtlrlnvenpklws
    aeipnlyravvelhtadgtlieaeacdvgfrevriengllllngkpllirgvnrhehhpl
    hgqvmdeqtmvqdillmkqnnfnavrcshypnhplwytlcdryglyvvdeaniethgmvp
    mnrltddprwlpamservtrmvqrdrnhpsviiwslgnesghganhdalyrwiksvdpsr
    pvqyegggadttatdiicpmyarvdedqpfpavpkwsikkwlslpgetrplilceyaham
    gnslggfakywqafrqyprlqggfvwdwvdqslikydengnpwsayggdfgdtpndrqfc
    mnglvfadrtphpalteakhqqqffqfrlsgqtievtseylfrhsdnellhwmvaldgkp
    lasgevpldvapqgkqlielpelpqpesagqlwltvrvvqpnatawseaghisawqqwrl
    aenlsvtlpaashaiphlttsemdfcielgnkrwqfnrqsgflsqmwigdkkqlltplrd
    qftrapldndigvseatridpnawverwkaaghyqaeaallqctadtladavlittahaw
    qhqgktlfisrktyridgsgqmaitvdvevasdtphpariglncqlaqvaervnwlglgp
    qenypdrltaacfdrwdlplsdmytpyvfpsenglrcgtrelnygphqwrgdfqfnisry
    sqqqlmetshrhllhaeegtwlnidgfhmgiggddswspsvsaefqlsagryhyqlvwcq
    k
    

  • Chain 'L':
    Sequence, based on SEQRES records: (download)
    >1jz1L (L:)
    tmitdslavvlqrrdwenpgvtqlnrlaahppfaswrnseeartdrpsqqlrslngewrf
    awfpapeavpeswlecdlpeadtvvvpsnwqmhgydapiytnvtypitvnppfvptenpt
    gcysltfnvdeswlqegqtriifdgvnsafhlwcngrwvgygqdsrlpsefdlsaflrag
    enrlavmvlrwsdgsyledqdmwrmsgifrdvsllhkpttqisdfhvatrfnddfsravl
    eaevqmcgelrdylrvtvslwqgetqvasgtapfggeiiderggyadrvtlrlnvenpkl
    wsaeipnlyravvelhtadgtlieaeacdvgfrevriengllllngkpllirgvnrhehh
    plhgqvmdeqtmvqdillmkqnnfnavrcshypnhplwytlcdryglyvvdeaniethgm
    vpmnrltddprwlpamservtrmvqrdrnhpsviiwslgnesghganhdalyrwiksvdp
    srpvqyegggadttatdiicpmyarvdedqpfpavpkwsikkwlslpgetrplilceyah
    amgnslggfakywqafrqyprlqggfvwdwvdqslikydengnpwsayggdfgdtpndrq
    fcmnglvfadrtphpalteakhqqqffqfrlsgqtievtseylfrhsdnellhwmvaldg
    kplasgevpldvapqgkqlielpelpqpesagqlwltvrvvqpnatawseaghisawqqw
    rlaenlsvtlpaashaiphlttsemdfcielgnkrwqfnrqsgflsqmwigdkkqlltpl
    rdqftrapldndigvseatridpnawverwkaaghyqaeaallqctadtladavlittah
    awqhqgktlfisrktyridgsgqmaitvdvevasdtphpariglncqlaqvaervnwlgl
    gpqenypdrltaacfdrwdlplsdmytpyvfpsenglrcgtrelnygphqwrgdfqfnis
    rysqqqlmetshrhllhaeegtwlnidgfhmgiggddswspsvsaefqlsagryhyqlvw
    cqk
    

    Sequence, based on observed residues (ATOM records): (download)
    >1jz1L (L:)
    itdslavvlqrrdwenpgvtqlnrlaahppfaswrnseeartdrpsqqlrslngewrfaw
    fpapeavpeswlecdlpeadtvvvpsnwqmhgydapiytnvtypitvnppfvptenptgc
    ysltfnvdeswlqegqtriifdgvnsafhlwcngrwvgygqdsrlpsefdlsaflragen
    rlavmvlrwsdgsyledqdmwrmsgifrdvsllhkpttqisdfhvatrfnddfsravlea
    evqmcgelrdylrvtvslwqgetqvasgtapfggeiiderggyadrvtlrlnvenpklws
    aeipnlyravvelhtadgtlieaeacdvgfrevriengllllngkpllirgvnrhehhpl
    hgqvmdeqtmvqdillmkqnnfnavrcshypnhplwytlcdryglyvvdeaniethgmvp
    mnrltddprwlpamservtrmvqrdrnhpsviiwslgnesghganhdalyrwiksvdpsr
    pvqyegggadttatdiicpmyarvdedqpfpavpkwsikkwlslpgetrplilceyaham
    gnslggfakywqafrqyprlqggfvwdwvdqslikydengnpwsayggdfgdtpndrqfc
    mnglvfadrtphpalteakhqqqffqfrlsgqtievtseylfrhsdnellhwmvaldgkp
    lasgevpldvapqgkqlielpelpqpesagqlwltvrvvqpnatawseaghisawqqwrl
    aenlsvtlpaashaiphlttsemdfcielgnkrwqfnrqsgflsqmwigdkkqlltplrd
    qftrapldndigvseatridpnawverwkaaghyqaeaallqctadtladavlittahaw
    qhqgktlfisrktyridgsgqmaitvdvevasdtphpariglncqlaqvaervnwlglgp
    qenypdrltaacfdrwdlplsdmytpyvfpsenglrcgtrelnygphqwrgdfqfnisry
    sqqqlmetshrhllhaeegtwlnidgfhmgiggddswspsvsaefqlsagryhyqlvwcq
    k
    

  • Chain 'M':
    Sequence, based on SEQRES records: (download)
    >1jz1M (M:)
    tmitdslavvlqrrdwenpgvtqlnrlaahppfaswrnseeartdrpsqqlrslngewrf
    awfpapeavpeswlecdlpeadtvvvpsnwqmhgydapiytnvtypitvnppfvptenpt
    gcysltfnvdeswlqegqtriifdgvnsafhlwcngrwvgygqdsrlpsefdlsaflrag
    enrlavmvlrwsdgsyledqdmwrmsgifrdvsllhkpttqisdfhvatrfnddfsravl
    eaevqmcgelrdylrvtvslwqgetqvasgtapfggeiiderggyadrvtlrlnvenpkl
    wsaeipnlyravvelhtadgtlieaeacdvgfrevriengllllngkpllirgvnrhehh
    plhgqvmdeqtmvqdillmkqnnfnavrcshypnhplwytlcdryglyvvdeaniethgm
    vpmnrltddprwlpamservtrmvqrdrnhpsviiwslgnesghganhdalyrwiksvdp
    srpvqyegggadttatdiicpmyarvdedqpfpavpkwsikkwlslpgetrplilceyah
    amgnslggfakywqafrqyprlqggfvwdwvdqslikydengnpwsayggdfgdtpndrq
    fcmnglvfadrtphpalteakhqqqffqfrlsgqtievtseylfrhsdnellhwmvaldg
    kplasgevpldvapqgkqlielpelpqpesagqlwltvrvvqpnatawseaghisawqqw
    rlaenlsvtlpaashaiphlttsemdfcielgnkrwqfnrqsgflsqmwigdkkqlltpl
    rdqftrapldndigvseatridpnawverwkaaghyqaeaallqctadtladavlittah
    awqhqgktlfisrktyridgsgqmaitvdvevasdtphpariglncqlaqvaervnwlgl
    gpqenypdrltaacfdrwdlplsdmytpyvfpsenglrcgtrelnygphqwrgdfqfnis
    rysqqqlmetshrhllhaeegtwlnidgfhmgiggddswspsvsaefqlsagryhyqlvw
    cqk
    

    Sequence, based on observed residues (ATOM records): (download)
    >1jz1M (M:)
    itdslavvlqrrdwenpgvtqlnrlaahppfaswrnseeartdrpsqqlrslngewrfaw
    fpapeavpeswlecdlpeadtvvvpsnwqmhgydapiytnvtypitvnppfvptenptgc
    ysltfnvdeswlqegqtriifdgvnsafhlwcngrwvgygqdsrlpsefdlsaflragen
    rlavmvlrwsdgsyledqdmwrmsgifrdvsllhkpttqisdfhvatrfnddfsravlea
    evqmcgelrdylrvtvslwqgetqvasgtapfggeiiderggyadrvtlrlnvenpklws
    aeipnlyravvelhtadgtlieaeacdvgfrevriengllllngkpllirgvnrhehhpl
    hgqvmdeqtmvqdillmkqnnfnavrcshypnhplwytlcdryglyvvdeaniethgmvp
    mnrltddprwlpamservtrmvqrdrnhpsviiwslgnesghganhdalyrwiksvdpsr
    pvqyegggadttatdiicpmyarvdedqpfpavpkwsikkwlslpgetrplilceyaham
    gnslggfakywqafrqyprlqggfvwdwvdqslikydengnpwsayggdfgdtpndrqfc
    mnglvfadrtphpalteakhqqqffqfrlsgqtievtseylfrhsdnellhwmvaldgkp
    lasgevpldvapqgkqlielpelpqpesagqlwltvrvvqpnatawseaghisawqqwrl
    aenlsvtlpaashaiphlttsemdfcielgnkrwqfnrqsgflsqmwigdkkqlltplrd
    qftrapldndigvseatridpnawverwkaaghyqaeaallqctadtladavlittahaw
    qhqgktlfisrktyridgsgqmaitvdvevasdtphpariglncqlaqvaervnwlglgp
    qenypdrltaacfdrwdlplsdmytpyvfpsenglrcgtrelnygphqwrgdfqfnisry
    sqqqlmetshrhllhaeegtwlnidgfhmgiggddswspsvsaefqlsagryhyqlvwcq
    k
    

  • Chain 'N':
    Sequence, based on SEQRES records: (download)
    >1jz1N (N:)
    tmitdslavvlqrrdwenpgvtqlnrlaahppfaswrnseeartdrpsqqlrslngewrf
    awfpapeavpeswlecdlpeadtvvvpsnwqmhgydapiytnvtypitvnppfvptenpt
    gcysltfnvdeswlqegqtriifdgvnsafhlwcngrwvgygqdsrlpsefdlsaflrag
    enrlavmvlrwsdgsyledqdmwrmsgifrdvsllhkpttqisdfhvatrfnddfsravl
    eaevqmcgelrdylrvtvslwqgetqvasgtapfggeiiderggyadrvtlrlnvenpkl
    wsaeipnlyravvelhtadgtlieaeacdvgfrevriengllllngkpllirgvnrhehh
    plhgqvmdeqtmvqdillmkqnnfnavrcshypnhplwytlcdryglyvvdeaniethgm
    vpmnrltddprwlpamservtrmvqrdrnhpsviiwslgnesghganhdalyrwiksvdp
    srpvqyegggadttatdiicpmyarvdedqpfpavpkwsikkwlslpgetrplilceyah
    amgnslggfakywqafrqyprlqggfvwdwvdqslikydengnpwsayggdfgdtpndrq
    fcmnglvfadrtphpalteakhqqqffqfrlsgqtievtseylfrhsdnellhwmvaldg
    kplasgevpldvapqgkqlielpelpqpesagqlwltvrvvqpnatawseaghisawqqw
    rlaenlsvtlpaashaiphlttsemdfcielgnkrwqfnrqsgflsqmwigdkkqlltpl
    rdqftrapldndigvseatridpnawverwkaaghyqaeaallqctadtladavlittah
    awqhqgktlfisrktyridgsgqmaitvdvevasdtphpariglncqlaqvaervnwlgl
    gpqenypdrltaacfdrwdlplsdmytpyvfpsenglrcgtrelnygphqwrgdfqfnis
    rysqqqlmetshrhllhaeegtwlnidgfhmgiggddswspsvsaefqlsagryhyqlvw
    cqk
    

    Sequence, based on observed residues (ATOM records): (download)
    >1jz1N (N:)
    itdslavvlqrrdwenpgvtqlnrlaahppfaswrnseeartdrpsqqlrslngewrfaw
    fpapeavpeswlecdlpeadtvvvpsnwqmhgydapiytnvtypitvnppfvptenptgc
    ysltfnvdeswlqegqtriifdgvnsafhlwcngrwvgygqdsrlpsefdlsaflragen
    rlavmvlrwsdgsyledqdmwrmsgifrdvsllhkpttqisdfhvatrfnddfsravlea
    evqmcgelrdylrvtvslwqgetqvasgtapfggeiiderggyadrvtlrlnvenpklws
    aeipnlyravvelhtadgtlieaeacdvgfrevriengllllngkpllirgvnrhehhpl
    hgqvmdeqtmvqdillmkqnnfnavrcshypnhplwytlcdryglyvvdeaniethgmvp
    mnrltddprwlpamservtrmvqrdrnhpsviiwslgnesghganhdalyrwiksvdpsr
    pvqyegggadttatdiicpmyarvdedqpfpavpkwsikkwlslpgetrplilceyaham
    gnslggfakywqafrqyprlqggfvwdwvdqslikydengnpwsayggdfgdtpndrqfc
    mnglvfadrtphpalteakhqqqffqfrlsgqtievtseylfrhsdnellhwmvaldgkp
    lasgevpldvapqgkqlielpelpqpesagqlwltvrvvqpnatawseaghisawqqwrl
    aenlsvtlpaashaiphlttsemdfcielgnkrwqfnrqsgflsqmwigdkkqlltplrd
    qftrapldndigvseatridpnawverwkaaghyqaeaallqctadtladavlittahaw
    qhqgktlfisrktyridgsgqmaitvdvevasdtphpariglncqlaqvaervnwlglgp
    qenypdrltaacfdrwdlplsdmytpyvfpsenglrcgtrelnygphqwrgdfqfnisry
    sqqqlmetshrhllhaeegtwlnidgfhmgiggddswspsvsaefqlsagryhyqlvwcq
    k
    

  • Chain 'O':
    Sequence, based on SEQRES records: (download)
    >1jz1O (O:)
    tmitdslavvlqrrdwenpgvtqlnrlaahppfaswrnseeartdrpsqqlrslngewrf
    awfpapeavpeswlecdlpeadtvvvpsnwqmhgydapiytnvtypitvnppfvptenpt
    gcysltfnvdeswlqegqtriifdgvnsafhlwcngrwvgygqdsrlpsefdlsaflrag
    enrlavmvlrwsdgsyledqdmwrmsgifrdvsllhkpttqisdfhvatrfnddfsravl
    eaevqmcgelrdylrvtvslwqgetqvasgtapfggeiiderggyadrvtlrlnvenpkl
    wsaeipnlyravvelhtadgtlieaeacdvgfrevriengllllngkpllirgvnrhehh
    plhgqvmdeqtmvqdillmkqnnfnavrcshypnhplwytlcdryglyvvdeaniethgm
    vpmnrltddprwlpamservtrmvqrdrnhpsviiwslgnesghganhdalyrwiksvdp
    srpvqyegggadttatdiicpmyarvdedqpfpavpkwsikkwlslpgetrplilceyah
    amgnslggfakywqafrqyprlqggfvwdwvdqslikydengnpwsayggdfgdtpndrq
    fcmnglvfadrtphpalteakhqqqffqfrlsgqtievtseylfrhsdnellhwmvaldg
    kplasgevpldvapqgkqlielpelpqpesagqlwltvrvvqpnatawseaghisawqqw
    rlaenlsvtlpaashaiphlttsemdfcielgnkrwqfnrqsgflsqmwigdkkqlltpl
    rdqftrapldndigvseatridpnawverwkaaghyqaeaallqctadtladavlittah
    awqhqgktlfisrktyridgsgqmaitvdvevasdtphpariglncqlaqvaervnwlgl
    gpqenypdrltaacfdrwdlplsdmytpyvfpsenglrcgtrelnygphqwrgdfqfnis
    rysqqqlmetshrhllhaeegtwlnidgfhmgiggddswspsvsaefqlsagryhyqlvw
    cqk
    

    Sequence, based on observed residues (ATOM records): (download)
    >1jz1O (O:)
    itdslavvlqrrdwenpgvtqlnrlaahppfaswrnseeartdrpsqqlrslngewrfaw
    fpapeavpeswlecdlpeadtvvvpsnwqmhgydapiytnvtypitvnppfvptenptgc
    ysltfnvdeswlqegqtriifdgvnsafhlwcngrwvgygqdsrlpsefdlsaflragen
    rlavmvlrwsdgsyledqdmwrmsgifrdvsllhkpttqisdfhvatrfnddfsravlea
    evqmcgelrdylrvtvslwqgetqvasgtapfggeiiderggyadrvtlrlnvenpklws
    aeipnlyravvelhtadgtlieaeacdvgfrevriengllllngkpllirgvnrhehhpl
    hgqvmdeqtmvqdillmkqnnfnavrcshypnhplwytlcdryglyvvdeaniethgmvp
    mnrltddprwlpamservtrmvqrdrnhpsviiwslgnesghganhdalyrwiksvdpsr
    pvqyegggadttatdiicpmyarvdedqpfpavpkwsikkwlslpgetrplilceyaham
    gnslggfakywqafrqyprlqggfvwdwvdqslikydengnpwsayggdfgdtpndrqfc
    mnglvfadrtphpalteakhqqqffqfrlsgqtievtseylfrhsdnellhwmvaldgkp
    lasgevpldvapqgkqlielpelpqpesagqlwltvrvvqpnatawseaghisawqqwrl
    aenlsvtlpaashaiphlttsemdfcielgnkrwqfnrqsgflsqmwigdkkqlltplrd
    qftrapldndigvseatridpnawverwkaaghyqaeaallqctadtladavlittahaw
    qhqgktlfisrktyridgsgqmaitvdvevasdtphpariglncqlaqvaervnwlglgp
    qenypdrltaacfdrwdlplsdmytpyvfpsenglrcgtrelnygphqwrgdfqfnisry
    sqqqlmetshrhllhaeegtwlnidgfhmgiggddswspsvsaefqlsagryhyqlvwcq
    k
    

  • Chain 'P':
    Sequence, based on SEQRES records: (download)
    >1jz1P (P:)
    tmitdslavvlqrrdwenpgvtqlnrlaahppfaswrnseeartdrpsqqlrslngewrf
    awfpapeavpeswlecdlpeadtvvvpsnwqmhgydapiytnvtypitvnppfvptenpt
    gcysltfnvdeswlqegqtriifdgvnsafhlwcngrwvgygqdsrlpsefdlsaflrag
    enrlavmvlrwsdgsyledqdmwrmsgifrdvsllhkpttqisdfhvatrfnddfsravl
    eaevqmcgelrdylrvtvslwqgetqvasgtapfggeiiderggyadrvtlrlnvenpkl
    wsaeipnlyravvelhtadgtlieaeacdvgfrevriengllllngkpllirgvnrhehh
    plhgqvmdeqtmvqdillmkqnnfnavrcshypnhplwytlcdryglyvvdeaniethgm
    vpmnrltddprwlpamservtrmvqrdrnhpsviiwslgnesghganhdalyrwiksvdp
    srpvqyegggadttatdiicpmyarvdedqpfpavpkwsikkwlslpgetrplilceyah
    amgnslggfakywqafrqyprlqggfvwdwvdqslikydengnpwsayggdfgdtpndrq
    fcmnglvfadrtphpalteakhqqqffqfrlsgqtievtseylfrhsdnellhwmvaldg
    kplasgevpldvapqgkqlielpelpqpesagqlwltvrvvqpnatawseaghisawqqw
    rlaenlsvtlpaashaiphlttsemdfcielgnkrwqfnrqsgflsqmwigdkkqlltpl
    rdqftrapldndigvseatridpnawverwkaaghyqaeaallqctadtladavlittah
    awqhqgktlfisrktyridgsgqmaitvdvevasdtphpariglncqlaqvaervnwlgl
    gpqenypdrltaacfdrwdlplsdmytpyvfpsenglrcgtrelnygphqwrgdfqfnis
    rysqqqlmetshrhllhaeegtwlnidgfhmgiggddswspsvsaefqlsagryhyqlvw
    cqk
    

    Sequence, based on observed residues (ATOM records): (download)
    >1jz1P (P:)
    itdslavvlqrrdwenpgvtqlnrlaahppfaswrnseeartdrpsqqlrslngewrfaw
    fpapeavpeswlecdlpeadtvvvpsnwqmhgydapiytnvtypitvnppfvptenptgc
    ysltfnvdeswlqegqtriifdgvnsafhlwcngrwvgygqdsrlpsefdlsaflragen
    rlavmvlrwsdgsyledqdmwrmsgifrdvsllhkpttqisdfhvatrfnddfsravlea
    evqmcgelrdylrvtvslwqgetqvasgtapfggeiiderggyadrvtlrlnvenpklws
    aeipnlyravvelhtadgtlieaeacdvgfrevriengllllngkpllirgvnrhehhpl
    hgqvmdeqtmvqdillmkqnnfnavrcshypnhplwytlcdryglyvvdeaniethgmvp
    mnrltddprwlpamservtrmvqrdrnhpsviiwslgnesghganhdalyrwiksvdpsr
    pvqyegggadttatdiicpmyarvdedqpfpavpkwsikkwlslpgetrplilceyaham
    gnslggfakywqafrqyprlqggfvwdwvdqslikydengnpwsayggdfgdtpndrqfc
    mnglvfadrtphpalteakhqqqffqfrlsgqtievtseylfrhsdnellhwmvaldgkp
    lasgevpldvapqgkqlielpelpqpesagqlwltvrvvqpnatawseaghisawqqwrl
    aenlsvtlpaashaiphlttsemdfcielgnkrwqfnrqsgflsqmwigdkkqlltplrd
    qftrapldndigvseatridpnawverwkaaghyqaeaallqctadtladavlittahaw
    qhqgktlfisrktyridgsgqmaitvdvevasdtphpariglncqlaqvaervnwlglgp
    qenypdrltaacfdrwdlplsdmytpyvfpsenglrcgtrelnygphqwrgdfqfnisry
    sqqqlmetshrhllhaeegtwlnidgfhmgiggddswspsvsaefqlsagryhyqlvwcq
    k