PDB entry 1jz1

View 1jz1 on RCSB PDB site
Description: e. coli (lacz) beta-galactosidase-trapped 2-f-galactosyl-enzyme intermediate. chains i-p, see remark 400
Deposited on 2001-09-13, released 2001-12-07
The last revision prior to the SCOP 1.61 freeze date was dated 2001-12-07, with a file datestamp of 2001-12-07.
Experiment type: XRAY
Resolution: 2.6 Å
R-factor: 0.23
AEROSPACI score: 0.19 (click here for full SPACI score report)

Chains and heterogens:

PDB Chain Sequences:

  • Chain 'I':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1jz1I (I:)
    itdslavvlqrrdwenpgvtqlnrlaahppfaswrnseeartdrpsqqlrslngewrfaw
    fpapeavpeswlecdlpeadtvvvpsnwqmhgydapiytnvtypitvnppfvptenptgc
    ysltfnvdeswlqegqtriifdgvnsafhlwcngrwvgygqdsrlpsefdlsaflragen
    rlavmvlrwsdgsyledqdmwrmsgifrdvsllhkpttqisdfhvatrfnddfsravlea
    evqmcgelrdylrvtvslwqgetqvasgtapfggeiiderggyadrvtlrlnvenpklws
    aeipnlyravvelhtadgtlieaeacdvgfrevriengllllngkpllirgvnrhehhpl
    hgqvmdeqtmvqdillmkqnnfnavrcshypnhplwytlcdryglyvvdeaniethgmvp
    mnrltddprwlpamservtrmvqrdrnhpsviiwslgnesghganhdalyrwiksvdpsr
    pvqyegggadttatdiicpmyarvdedqpfpavpkwsikkwlslpgetrplilceyaham
    gnslggfakywqafrqyprlqggfvwdwvdqslikydengnpwsayggdfgdtpndrqfc
    mnglvfadrtphpalteakhqqqffqfrlsgqtievtseylfrhsdnellhwmvaldgkp
    lasgevpldvapqgkqlielpelpqpesagqlwltvrvvqpnatawseaghisawqqwrl
    aenlsvtlpaashaiphlttsemdfcielgnkrwqfnrqsgflsqmwigdkkqlltplrd
    qftrapldndigvseatridpnawverwkaaghyqaeaallqctadtladavlittahaw
    qhqgktlfisrktyridgsgqmaitvdvevasdtphpariglncqlaqvaervnwlglgp
    qenypdrltaacfdrwdlplsdmytpyvfpsenglrcgtrelnygphqwrgdfqfnisry
    sqqqlmetshrhllhaeegtwlnidgfhmgiggddswspsvsaefqlsagryhyqlvwcq
    k
    

  • Chain 'J':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1jz1J (J:)
    itdslavvlqrrdwenpgvtqlnrlaahppfaswrnseeartdrpsqqlrslngewrfaw
    fpapeavpeswlecdlpeadtvvvpsnwqmhgydapiytnvtypitvnppfvptenptgc
    ysltfnvdeswlqegqtriifdgvnsafhlwcngrwvgygqdsrlpsefdlsaflragen
    rlavmvlrwsdgsyledqdmwrmsgifrdvsllhkpttqisdfhvatrfnddfsravlea
    evqmcgelrdylrvtvslwqgetqvasgtapfggeiiderggyadrvtlrlnvenpklws
    aeipnlyravvelhtadgtlieaeacdvgfrevriengllllngkpllirgvnrhehhpl
    hgqvmdeqtmvqdillmkqnnfnavrcshypnhplwytlcdryglyvvdeaniethgmvp
    mnrltddprwlpamservtrmvqrdrnhpsviiwslgnesghganhdalyrwiksvdpsr
    pvqyegggadttatdiicpmyarvdedqpfpavpkwsikkwlslpgetrplilceyaham
    gnslggfakywqafrqyprlqggfvwdwvdqslikydengnpwsayggdfgdtpndrqfc
    mnglvfadrtphpalteakhqqqffqfrlsgqtievtseylfrhsdnellhwmvaldgkp
    lasgevpldvapqgkqlielpelpqpesagqlwltvrvvqpnatawseaghisawqqwrl
    aenlsvtlpaashaiphlttsemdfcielgnkrwqfnrqsgflsqmwigdkkqlltplrd
    qftrapldndigvseatridpnawverwkaaghyqaeaallqctadtladavlittahaw
    qhqgktlfisrktyridgsgqmaitvdvevasdtphpariglncqlaqvaervnwlglgp
    qenypdrltaacfdrwdlplsdmytpyvfpsenglrcgtrelnygphqwrgdfqfnisry
    sqqqlmetshrhllhaeegtwlnidgfhmgiggddswspsvsaefqlsagryhyqlvwcq
    k
    

  • Chain 'K':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1jz1K (K:)
    itdslavvlqrrdwenpgvtqlnrlaahppfaswrnseeartdrpsqqlrslngewrfaw
    fpapeavpeswlecdlpeadtvvvpsnwqmhgydapiytnvtypitvnppfvptenptgc
    ysltfnvdeswlqegqtriifdgvnsafhlwcngrwvgygqdsrlpsefdlsaflragen
    rlavmvlrwsdgsyledqdmwrmsgifrdvsllhkpttqisdfhvatrfnddfsravlea
    evqmcgelrdylrvtvslwqgetqvasgtapfggeiiderggyadrvtlrlnvenpklws
    aeipnlyravvelhtadgtlieaeacdvgfrevriengllllngkpllirgvnrhehhpl
    hgqvmdeqtmvqdillmkqnnfnavrcshypnhplwytlcdryglyvvdeaniethgmvp
    mnrltddprwlpamservtrmvqrdrnhpsviiwslgnesghganhdalyrwiksvdpsr
    pvqyegggadttatdiicpmyarvdedqpfpavpkwsikkwlslpgetrplilceyaham
    gnslggfakywqafrqyprlqggfvwdwvdqslikydengnpwsayggdfgdtpndrqfc
    mnglvfadrtphpalteakhqqqffqfrlsgqtievtseylfrhsdnellhwmvaldgkp
    lasgevpldvapqgkqlielpelpqpesagqlwltvrvvqpnatawseaghisawqqwrl
    aenlsvtlpaashaiphlttsemdfcielgnkrwqfnrqsgflsqmwigdkkqlltplrd
    qftrapldndigvseatridpnawverwkaaghyqaeaallqctadtladavlittahaw
    qhqgktlfisrktyridgsgqmaitvdvevasdtphpariglncqlaqvaervnwlglgp
    qenypdrltaacfdrwdlplsdmytpyvfpsenglrcgtrelnygphqwrgdfqfnisry
    sqqqlmetshrhllhaeegtwlnidgfhmgiggddswspsvsaefqlsagryhyqlvwcq
    k
    

  • Chain 'L':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1jz1L (L:)
    itdslavvlqrrdwenpgvtqlnrlaahppfaswrnseeartdrpsqqlrslngewrfaw
    fpapeavpeswlecdlpeadtvvvpsnwqmhgydapiytnvtypitvnppfvptenptgc
    ysltfnvdeswlqegqtriifdgvnsafhlwcngrwvgygqdsrlpsefdlsaflragen
    rlavmvlrwsdgsyledqdmwrmsgifrdvsllhkpttqisdfhvatrfnddfsravlea
    evqmcgelrdylrvtvslwqgetqvasgtapfggeiiderggyadrvtlrlnvenpklws
    aeipnlyravvelhtadgtlieaeacdvgfrevriengllllngkpllirgvnrhehhpl
    hgqvmdeqtmvqdillmkqnnfnavrcshypnhplwytlcdryglyvvdeaniethgmvp
    mnrltddprwlpamservtrmvqrdrnhpsviiwslgnesghganhdalyrwiksvdpsr
    pvqyegggadttatdiicpmyarvdedqpfpavpkwsikkwlslpgetrplilceyaham
    gnslggfakywqafrqyprlqggfvwdwvdqslikydengnpwsayggdfgdtpndrqfc
    mnglvfadrtphpalteakhqqqffqfrlsgqtievtseylfrhsdnellhwmvaldgkp
    lasgevpldvapqgkqlielpelpqpesagqlwltvrvvqpnatawseaghisawqqwrl
    aenlsvtlpaashaiphlttsemdfcielgnkrwqfnrqsgflsqmwigdkkqlltplrd
    qftrapldndigvseatridpnawverwkaaghyqaeaallqctadtladavlittahaw
    qhqgktlfisrktyridgsgqmaitvdvevasdtphpariglncqlaqvaervnwlglgp
    qenypdrltaacfdrwdlplsdmytpyvfpsenglrcgtrelnygphqwrgdfqfnisry
    sqqqlmetshrhllhaeegtwlnidgfhmgiggddswspsvsaefqlsagryhyqlvwcq
    k
    

  • Chain 'M':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1jz1M (M:)
    itdslavvlqrrdwenpgvtqlnrlaahppfaswrnseeartdrpsqqlrslngewrfaw
    fpapeavpeswlecdlpeadtvvvpsnwqmhgydapiytnvtypitvnppfvptenptgc
    ysltfnvdeswlqegqtriifdgvnsafhlwcngrwvgygqdsrlpsefdlsaflragen
    rlavmvlrwsdgsyledqdmwrmsgifrdvsllhkpttqisdfhvatrfnddfsravlea
    evqmcgelrdylrvtvslwqgetqvasgtapfggeiiderggyadrvtlrlnvenpklws
    aeipnlyravvelhtadgtlieaeacdvgfrevriengllllngkpllirgvnrhehhpl
    hgqvmdeqtmvqdillmkqnnfnavrcshypnhplwytlcdryglyvvdeaniethgmvp
    mnrltddprwlpamservtrmvqrdrnhpsviiwslgnesghganhdalyrwiksvdpsr
    pvqyegggadttatdiicpmyarvdedqpfpavpkwsikkwlslpgetrplilceyaham
    gnslggfakywqafrqyprlqggfvwdwvdqslikydengnpwsayggdfgdtpndrqfc
    mnglvfadrtphpalteakhqqqffqfrlsgqtievtseylfrhsdnellhwmvaldgkp
    lasgevpldvapqgkqlielpelpqpesagqlwltvrvvqpnatawseaghisawqqwrl
    aenlsvtlpaashaiphlttsemdfcielgnkrwqfnrqsgflsqmwigdkkqlltplrd
    qftrapldndigvseatridpnawverwkaaghyqaeaallqctadtladavlittahaw
    qhqgktlfisrktyridgsgqmaitvdvevasdtphpariglncqlaqvaervnwlglgp
    qenypdrltaacfdrwdlplsdmytpyvfpsenglrcgtrelnygphqwrgdfqfnisry
    sqqqlmetshrhllhaeegtwlnidgfhmgiggddswspsvsaefqlsagryhyqlvwcq
    k
    

  • Chain 'N':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1jz1N (N:)
    itdslavvlqrrdwenpgvtqlnrlaahppfaswrnseeartdrpsqqlrslngewrfaw
    fpapeavpeswlecdlpeadtvvvpsnwqmhgydapiytnvtypitvnppfvptenptgc
    ysltfnvdeswlqegqtriifdgvnsafhlwcngrwvgygqdsrlpsefdlsaflragen
    rlavmvlrwsdgsyledqdmwrmsgifrdvsllhkpttqisdfhvatrfnddfsravlea
    evqmcgelrdylrvtvslwqgetqvasgtapfggeiiderggyadrvtlrlnvenpklws
    aeipnlyravvelhtadgtlieaeacdvgfrevriengllllngkpllirgvnrhehhpl
    hgqvmdeqtmvqdillmkqnnfnavrcshypnhplwytlcdryglyvvdeaniethgmvp
    mnrltddprwlpamservtrmvqrdrnhpsviiwslgnesghganhdalyrwiksvdpsr
    pvqyegggadttatdiicpmyarvdedqpfpavpkwsikkwlslpgetrplilceyaham
    gnslggfakywqafrqyprlqggfvwdwvdqslikydengnpwsayggdfgdtpndrqfc
    mnglvfadrtphpalteakhqqqffqfrlsgqtievtseylfrhsdnellhwmvaldgkp
    lasgevpldvapqgkqlielpelpqpesagqlwltvrvvqpnatawseaghisawqqwrl
    aenlsvtlpaashaiphlttsemdfcielgnkrwqfnrqsgflsqmwigdkkqlltplrd
    qftrapldndigvseatridpnawverwkaaghyqaeaallqctadtladavlittahaw
    qhqgktlfisrktyridgsgqmaitvdvevasdtphpariglncqlaqvaervnwlglgp
    qenypdrltaacfdrwdlplsdmytpyvfpsenglrcgtrelnygphqwrgdfqfnisry
    sqqqlmetshrhllhaeegtwlnidgfhmgiggddswspsvsaefqlsagryhyqlvwcq
    k
    

  • Chain 'O':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1jz1O (O:)
    itdslavvlqrrdwenpgvtqlnrlaahppfaswrnseeartdrpsqqlrslngewrfaw
    fpapeavpeswlecdlpeadtvvvpsnwqmhgydapiytnvtypitvnppfvptenptgc
    ysltfnvdeswlqegqtriifdgvnsafhlwcngrwvgygqdsrlpsefdlsaflragen
    rlavmvlrwsdgsyledqdmwrmsgifrdvsllhkpttqisdfhvatrfnddfsravlea
    evqmcgelrdylrvtvslwqgetqvasgtapfggeiiderggyadrvtlrlnvenpklws
    aeipnlyravvelhtadgtlieaeacdvgfrevriengllllngkpllirgvnrhehhpl
    hgqvmdeqtmvqdillmkqnnfnavrcshypnhplwytlcdryglyvvdeaniethgmvp
    mnrltddprwlpamservtrmvqrdrnhpsviiwslgnesghganhdalyrwiksvdpsr
    pvqyegggadttatdiicpmyarvdedqpfpavpkwsikkwlslpgetrplilceyaham
    gnslggfakywqafrqyprlqggfvwdwvdqslikydengnpwsayggdfgdtpndrqfc
    mnglvfadrtphpalteakhqqqffqfrlsgqtievtseylfrhsdnellhwmvaldgkp
    lasgevpldvapqgkqlielpelpqpesagqlwltvrvvqpnatawseaghisawqqwrl
    aenlsvtlpaashaiphlttsemdfcielgnkrwqfnrqsgflsqmwigdkkqlltplrd
    qftrapldndigvseatridpnawverwkaaghyqaeaallqctadtladavlittahaw
    qhqgktlfisrktyridgsgqmaitvdvevasdtphpariglncqlaqvaervnwlglgp
    qenypdrltaacfdrwdlplsdmytpyvfpsenglrcgtrelnygphqwrgdfqfnisry
    sqqqlmetshrhllhaeegtwlnidgfhmgiggddswspsvsaefqlsagryhyqlvwcq
    k
    

  • Chain 'P':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1jz1P (P:)
    itdslavvlqrrdwenpgvtqlnrlaahppfaswrnseeartdrpsqqlrslngewrfaw
    fpapeavpeswlecdlpeadtvvvpsnwqmhgydapiytnvtypitvnppfvptenptgc
    ysltfnvdeswlqegqtriifdgvnsafhlwcngrwvgygqdsrlpsefdlsaflragen
    rlavmvlrwsdgsyledqdmwrmsgifrdvsllhkpttqisdfhvatrfnddfsravlea
    evqmcgelrdylrvtvslwqgetqvasgtapfggeiiderggyadrvtlrlnvenpklws
    aeipnlyravvelhtadgtlieaeacdvgfrevriengllllngkpllirgvnrhehhpl
    hgqvmdeqtmvqdillmkqnnfnavrcshypnhplwytlcdryglyvvdeaniethgmvp
    mnrltddprwlpamservtrmvqrdrnhpsviiwslgnesghganhdalyrwiksvdpsr
    pvqyegggadttatdiicpmyarvdedqpfpavpkwsikkwlslpgetrplilceyaham
    gnslggfakywqafrqyprlqggfvwdwvdqslikydengnpwsayggdfgdtpndrqfc
    mnglvfadrtphpalteakhqqqffqfrlsgqtievtseylfrhsdnellhwmvaldgkp
    lasgevpldvapqgkqlielpelpqpesagqlwltvrvvqpnatawseaghisawqqwrl
    aenlsvtlpaashaiphlttsemdfcielgnkrwqfnrqsgflsqmwigdkkqlltplrd
    qftrapldndigvseatridpnawverwkaaghyqaeaallqctadtladavlittahaw
    qhqgktlfisrktyridgsgqmaitvdvevasdtphpariglncqlaqvaervnwlglgp
    qenypdrltaacfdrwdlplsdmytpyvfpsenglrcgtrelnygphqwrgdfqfnisry
    sqqqlmetshrhllhaeegtwlnidgfhmgiggddswspsvsaefqlsagryhyqlvwcq
    k