PDB entry 1jyv

View 1jyv on RCSB PDB site
Description: E. COLI (lacZ) BETA-GALACTOSIDASE (E537Q) IN COMPLEX WITH ONPG
Class: hydrolase
Keywords: tim barrel (alpha/beta barrel), jelly-roll barrel, immunoglobulin, beta supersandwich, hydrolase
Deposited on 2001-09-13, released 2001-12-07
The last revision prior to the SCOPe 2.05 freeze date was dated 2009-02-24, with a file datestamp of 2009-03-01.
Experiment type: XRAY
Resolution: 1.75 Å
R-factor: 0.18
AEROSPACI score: 0.51 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: beta-galactosidase
    Species: Escherichia coli [TaxId:562]
    Gene: lacZ
    Database cross-references and differences (RAF-indexed):
    • Uniprot P00722 (Start-1022)
      • engineered (536)
    Domains in SCOPe 2.05: d1jyva1, d1jyva2, d1jyva3, d1jyva4, d1jyva5
  • Chain 'B':
    Compound: beta-galactosidase
    Species: Escherichia coli [TaxId:562]
    Gene: lacZ
    Database cross-references and differences (RAF-indexed):
    • Uniprot P00722 (Start-1022)
      • engineered (536)
    Domains in SCOPe 2.05: d1jyvb1, d1jyvb2, d1jyvb3, d1jyvb4, d1jyvb5
  • Chain 'C':
    Compound: beta-galactosidase
    Species: Escherichia coli [TaxId:562]
    Gene: lacZ
    Database cross-references and differences (RAF-indexed):
    • Uniprot P00722 (Start-1022)
      • engineered (536)
    Domains in SCOPe 2.05: d1jyvc1, d1jyvc2, d1jyvc3, d1jyvc4, d1jyvc5
  • Chain 'D':
    Compound: beta-galactosidase
    Species: Escherichia coli [TaxId:562]
    Gene: lacZ
    Database cross-references and differences (RAF-indexed):
    • Uniprot P00722 (Start-1022)
      • engineered (536)
    Domains in SCOPe 2.05: d1jyvd1, d1jyvd2, d1jyvd3, d1jyvd4, d1jyvd5
  • Heterogens: MG, NA, 145, DMS, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >1jyvA (A:)
    gshmledpvvlqrrdwenpgvtqlnrlaahppfaswrnseeartdrpsqqlrslngewrf
    awfpapeavpeswlecdlpeadtvvvpsnwqmhgydapiytnvtypitvnppfvptenpt
    gcysltfnvdeswlqegqtriifdgvnsafhlwcngrwvgygqdsrlpsefdlsaflrag
    enrlavmvlrwsdgsyledqdmwrmsgifrdvsllhkpttqisdfhvatrfnddfsravl
    eaevqmcgelrdylrvtvslwqgetqvasgtapfggeiiderggyadrvtlrlnvenpkl
    wsaeipnlyravvelhtadgtlieaeacdvgfrevriengllllngkpllirgvnrhehh
    plhgqvmdeqtmvqdillmkqnnfnavrcshypnhplwytlcdryglyvvdeaniethgm
    vpmnrltddprwlpamservtrmvqrdrnhpsviiwslgnesghganhdalyrwiksvdp
    srpvqyegggadttatdiicpmyarvdedqpfpavpkwsikkwlslpgetrplilcqyah
    amgnslggfakywqafrqyprlqggfvwdwvdqslikydengnpwsayggdfgdtpndrq
    fcmnglvfadrtphpalteakhqqqffqfrlsgqtievtseylfrhsdnellhwmvaldg
    kplasgevpldvapqgkqlielpelpqpesagqlwltvrvvqpnatawseaghisawqqw
    rlaenlsvtlpaashaiphlttsemdfcielgnkrwqfnrqsgflsqmwigdkkqlltpl
    rdqftrapldndigvseatridpnawverwkaaghyqaeaallqctadtladavlittah
    awqhqgktlfisrktyridgsgqmaitvdvevasdtphpariglncqlaqvaervnwlgl
    gpqenypdrltaacfdrwdlplsdmytpyvfpsenglrcgtrelnygphqwrgdfqfnis
    rysqqqlmetshrhllhaeegtwlnidgfhmgiggddswspsvsaefqlsagryhyqlvw
    cqk
    

    Sequence, based on observed residues (ATOM records): (download)
    >1jyvA (A:)
    rrdwenpgvtqlnrlaahppfaswrnseeartdrpsqqlrslngewrfawfpapeavpes
    wlecdlpeadtvvvpsnwqmhgydapiytnvtypitvnppfvptenptgcysltfnvdes
    wlqegqtriifdgvnsafhlwcngrwvgygqdsrlpsefdlsaflragenrlavmvlrws
    dgsyledqdmwrmsgifrdvsllhkpttqisdfhvatrfnddfsravleaevqmcgelrd
    ylrvtvslwqgetqvasgtapfggeiiderggyadrvtlrlnvenpklwsaeipnlyrav
    velhtadgtlieaeacdvgfrevriengllllngkpllirgvnrhehhplhgqvmdeqtm
    vqdillmkqnnfnavrcshypnhplwytlcdryglyvvdeaniethgmvpmnrltddprw
    lpamservtrmvqrdrnhpsviiwslgnesghganhdalyrwiksvdpsrpvqyegggad
    ttatdiicpmyarvdedqpfpavpkwsikkwlslpgetrplilcqyahamgnslggfaky
    wqafrqyprlqggfvwdwvdqslikydengnpwsayggdfgdtpndrqfcmnglvfadrt
    phpalteakhqqqffqfrlsgqtievtseylfrhsdnellhwmvaldgkplasgevpldv
    apqgkqlielpelpqpesagqlwltvrvvqpnatawseaghisawqqwrlaenlsvtlpa
    ashaiphlttsemdfcielgnkrwqfnrqsgflsqmwigdkkqlltplrdqftrapldnd
    igvseatridpnawverwkaaghyqaeaallqctadtladavlittahawqhqgktlfis
    rktyridgsgqmaitvdvevasdtphpariglncqlaqvaervnwlglgpqenypdrlta
    acfdrwdlplsdmytpyvfpsenglrcgtrelnygphqwrgdfqfnisrysqqqlmetsh
    rhllhaeegtwlnidgfhmgiggddswspsvsaefqlsagryhyqlvwcqk
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >1jyvB (B:)
    gshmledpvvlqrrdwenpgvtqlnrlaahppfaswrnseeartdrpsqqlrslngewrf
    awfpapeavpeswlecdlpeadtvvvpsnwqmhgydapiytnvtypitvnppfvptenpt
    gcysltfnvdeswlqegqtriifdgvnsafhlwcngrwvgygqdsrlpsefdlsaflrag
    enrlavmvlrwsdgsyledqdmwrmsgifrdvsllhkpttqisdfhvatrfnddfsravl
    eaevqmcgelrdylrvtvslwqgetqvasgtapfggeiiderggyadrvtlrlnvenpkl
    wsaeipnlyravvelhtadgtlieaeacdvgfrevriengllllngkpllirgvnrhehh
    plhgqvmdeqtmvqdillmkqnnfnavrcshypnhplwytlcdryglyvvdeaniethgm
    vpmnrltddprwlpamservtrmvqrdrnhpsviiwslgnesghganhdalyrwiksvdp
    srpvqyegggadttatdiicpmyarvdedqpfpavpkwsikkwlslpgetrplilcqyah
    amgnslggfakywqafrqyprlqggfvwdwvdqslikydengnpwsayggdfgdtpndrq
    fcmnglvfadrtphpalteakhqqqffqfrlsgqtievtseylfrhsdnellhwmvaldg
    kplasgevpldvapqgkqlielpelpqpesagqlwltvrvvqpnatawseaghisawqqw
    rlaenlsvtlpaashaiphlttsemdfcielgnkrwqfnrqsgflsqmwigdkkqlltpl
    rdqftrapldndigvseatridpnawverwkaaghyqaeaallqctadtladavlittah
    awqhqgktlfisrktyridgsgqmaitvdvevasdtphpariglncqlaqvaervnwlgl
    gpqenypdrltaacfdrwdlplsdmytpyvfpsenglrcgtrelnygphqwrgdfqfnis
    rysqqqlmetshrhllhaeegtwlnidgfhmgiggddswspsvsaefqlsagryhyqlvw
    cqk
    

    Sequence, based on observed residues (ATOM records): (download)
    >1jyvB (B:)
    rrdwenpgvtqlnrlaahppfaswrnseeartdrpsqqlrslngewrfawfpapeavpes
    wlecdlpeadtvvvpsnwqmhgydapiytnvtypitvnppfvptenptgcysltfnvdes
    wlqegqtriifdgvnsafhlwcngrwvgygqdsrlpsefdlsaflragenrlavmvlrws
    dgsyledqdmwrmsgifrdvsllhkpttqisdfhvatrfnddfsravleaevqmcgelrd
    ylrvtvslwqgetqvasgtapfggeiiderggyadrvtlrlnvenpklwsaeipnlyrav
    velhtadgtlieaeacdvgfrevriengllllngkpllirgvnrhehhplhgqvmdeqtm
    vqdillmkqnnfnavrcshypnhplwytlcdryglyvvdeaniethgmvpmnrltddprw
    lpamservtrmvqrdrnhpsviiwslgnesghganhdalyrwiksvdpsrpvqyegggad
    ttatdiicpmyarvdedqpfpavpkwsikkwlslpgetrplilcqyahamgnslggfaky
    wqafrqyprlqggfvwdwvdqslikydengnpwsayggdfgdtpndrqfcmnglvfadrt
    phpalteakhqqqffqfrlsgqtievtseylfrhsdnellhwmvaldgkplasgevpldv
    apqgkqlielpelpqpesagqlwltvrvvqpnatawseaghisawqqwrlaenlsvtlpa
    ashaiphlttsemdfcielgnkrwqfnrqsgflsqmwigdkkqlltplrdqftrapldnd
    igvseatridpnawverwkaaghyqaeaallqctadtladavlittahawqhqgktlfis
    rktyridgsgqmaitvdvevasdtphpariglncqlaqvaervnwlglgpqenypdrlta
    acfdrwdlplsdmytpyvfpsenglrcgtrelnygphqwrgdfqfnisrysqqqlmetsh
    rhllhaeegtwlnidgfhmgiggddswspsvsaefqlsagryhyqlvwcqk
    

  • Chain 'C':
    Sequence, based on SEQRES records: (download)
    >1jyvC (C:)
    gshmledpvvlqrrdwenpgvtqlnrlaahppfaswrnseeartdrpsqqlrslngewrf
    awfpapeavpeswlecdlpeadtvvvpsnwqmhgydapiytnvtypitvnppfvptenpt
    gcysltfnvdeswlqegqtriifdgvnsafhlwcngrwvgygqdsrlpsefdlsaflrag
    enrlavmvlrwsdgsyledqdmwrmsgifrdvsllhkpttqisdfhvatrfnddfsravl
    eaevqmcgelrdylrvtvslwqgetqvasgtapfggeiiderggyadrvtlrlnvenpkl
    wsaeipnlyravvelhtadgtlieaeacdvgfrevriengllllngkpllirgvnrhehh
    plhgqvmdeqtmvqdillmkqnnfnavrcshypnhplwytlcdryglyvvdeaniethgm
    vpmnrltddprwlpamservtrmvqrdrnhpsviiwslgnesghganhdalyrwiksvdp
    srpvqyegggadttatdiicpmyarvdedqpfpavpkwsikkwlslpgetrplilcqyah
    amgnslggfakywqafrqyprlqggfvwdwvdqslikydengnpwsayggdfgdtpndrq
    fcmnglvfadrtphpalteakhqqqffqfrlsgqtievtseylfrhsdnellhwmvaldg
    kplasgevpldvapqgkqlielpelpqpesagqlwltvrvvqpnatawseaghisawqqw
    rlaenlsvtlpaashaiphlttsemdfcielgnkrwqfnrqsgflsqmwigdkkqlltpl
    rdqftrapldndigvseatridpnawverwkaaghyqaeaallqctadtladavlittah
    awqhqgktlfisrktyridgsgqmaitvdvevasdtphpariglncqlaqvaervnwlgl
    gpqenypdrltaacfdrwdlplsdmytpyvfpsenglrcgtrelnygphqwrgdfqfnis
    rysqqqlmetshrhllhaeegtwlnidgfhmgiggddswspsvsaefqlsagryhyqlvw
    cqk
    

    Sequence, based on observed residues (ATOM records): (download)
    >1jyvC (C:)
    rrdwenpgvtqlnrlaahppfaswrnseeartdrpsqqlrslngewrfawfpapeavpes
    wlecdlpeadtvvvpsnwqmhgydapiytnvtypitvnppfvptenptgcysltfnvdes
    wlqegqtriifdgvnsafhlwcngrwvgygqdsrlpsefdlsaflragenrlavmvlrws
    dgsyledqdmwrmsgifrdvsllhkpttqisdfhvatrfnddfsravleaevqmcgelrd
    ylrvtvslwqgetqvasgtapfggeiiderggyadrvtlrlnvenpklwsaeipnlyrav
    velhtadgtlieaeacdvgfrevriengllllngkpllirgvnrhehhplhgqvmdeqtm
    vqdillmkqnnfnavrcshypnhplwytlcdryglyvvdeaniethgmvpmnrltddprw
    lpamservtrmvqrdrnhpsviiwslgnesghganhdalyrwiksvdpsrpvqyegggad
    ttatdiicpmyarvdedqpfpavpkwsikkwlslpgetrplilcqyahamgnslggfaky
    wqafrqyprlqggfvwdwvdqslikydengnpwsayggdfgdtpndrqfcmnglvfadrt
    phpalteakhqqqffqfrlsgqtievtseylfrhsdnellhwmvaldgkplasgevpldv
    apqgkqlielpelpqpesagqlwltvrvvqpnatawseaghisawqqwrlaenlsvtlpa
    ashaiphlttsemdfcielgnkrwqfnrqsgflsqmwigdkkqlltplrdqftrapldnd
    igvseatridpnawverwkaaghyqaeaallqctadtladavlittahawqhqgktlfis
    rktyridgsgqmaitvdvevasdtphpariglncqlaqvaervnwlglgpqenypdrlta
    acfdrwdlplsdmytpyvfpsenglrcgtrelnygphqwrgdfqfnisrysqqqlmetsh
    rhllhaeegtwlnidgfhmgiggddswspsvsaefqlsagryhyqlvwcqk
    

  • Chain 'D':
    Sequence, based on SEQRES records: (download)
    >1jyvD (D:)
    gshmledpvvlqrrdwenpgvtqlnrlaahppfaswrnseeartdrpsqqlrslngewrf
    awfpapeavpeswlecdlpeadtvvvpsnwqmhgydapiytnvtypitvnppfvptenpt
    gcysltfnvdeswlqegqtriifdgvnsafhlwcngrwvgygqdsrlpsefdlsaflrag
    enrlavmvlrwsdgsyledqdmwrmsgifrdvsllhkpttqisdfhvatrfnddfsravl
    eaevqmcgelrdylrvtvslwqgetqvasgtapfggeiiderggyadrvtlrlnvenpkl
    wsaeipnlyravvelhtadgtlieaeacdvgfrevriengllllngkpllirgvnrhehh
    plhgqvmdeqtmvqdillmkqnnfnavrcshypnhplwytlcdryglyvvdeaniethgm
    vpmnrltddprwlpamservtrmvqrdrnhpsviiwslgnesghganhdalyrwiksvdp
    srpvqyegggadttatdiicpmyarvdedqpfpavpkwsikkwlslpgetrplilcqyah
    amgnslggfakywqafrqyprlqggfvwdwvdqslikydengnpwsayggdfgdtpndrq
    fcmnglvfadrtphpalteakhqqqffqfrlsgqtievtseylfrhsdnellhwmvaldg
    kplasgevpldvapqgkqlielpelpqpesagqlwltvrvvqpnatawseaghisawqqw
    rlaenlsvtlpaashaiphlttsemdfcielgnkrwqfnrqsgflsqmwigdkkqlltpl
    rdqftrapldndigvseatridpnawverwkaaghyqaeaallqctadtladavlittah
    awqhqgktlfisrktyridgsgqmaitvdvevasdtphpariglncqlaqvaervnwlgl
    gpqenypdrltaacfdrwdlplsdmytpyvfpsenglrcgtrelnygphqwrgdfqfnis
    rysqqqlmetshrhllhaeegtwlnidgfhmgiggddswspsvsaefqlsagryhyqlvw
    cqk
    

    Sequence, based on observed residues (ATOM records): (download)
    >1jyvD (D:)
    rrdwenpgvtqlnrlaahppfaswrnseeartdrpsqqlrslngewrfawfpapeavpes
    wlecdlpeadtvvvpsnwqmhgydapiytnvtypitvnppfvptenptgcysltfnvdes
    wlqegqtriifdgvnsafhlwcngrwvgygqdsrlpsefdlsaflragenrlavmvlrws
    dgsyledqdmwrmsgifrdvsllhkpttqisdfhvatrfnddfsravleaevqmcgelrd
    ylrvtvslwqgetqvasgtapfggeiiderggyadrvtlrlnvenpklwsaeipnlyrav
    velhtadgtlieaeacdvgfrevriengllllngkpllirgvnrhehhplhgqvmdeqtm
    vqdillmkqnnfnavrcshypnhplwytlcdryglyvvdeaniethgmvpmnrltddprw
    lpamservtrmvqrdrnhpsviiwslgnesghganhdalyrwiksvdpsrpvqyegggad
    ttatdiicpmyarvdedqpfpavpkwsikkwlslpgetrplilcqyahamgnslggfaky
    wqafrqyprlqggfvwdwvdqslikydengnpwsayggdfgdtpndrqfcmnglvfadrt
    phpalteakhqqqffqfrlsgqtievtseylfrhsdnellhwmvaldgkplasgevpldv
    apqgkqlielpelpqpesagqlwltvrvvqpnatawseaghisawqqwrlaenlsvtlpa
    ashaiphlttsemdfcielgnkrwqfnrqsgflsqmwigdkkqlltplrdqftrapldnd
    igvseatridpnawverwkaaghyqaeaallqctadtladavlittahawqhqgktlfis
    rktyridgsgqmaitvdvevasdtphpariglncqlaqvaervnwlglgpqenypdrlta
    acfdrwdlplsdmytpyvfpsenglrcgtrelnygphqwrgdfqfnisrysqqqlmetsh
    rhllhaeegtwlnidgfhmgiggddswspsvsaefqlsagryhyqlvwcqk