PDB entry 1jyu

View 1jyu on RCSB PDB site
Description: Xray Structure of Grb2 SH2 Domain
Class: signaling protein
Keywords: receptor binding, regulatory, SIGNALING PROTEIN
Deposited on 2001-09-13, released 2002-03-13
The last revision prior to the SCOPe 2.06 freeze date was dated 2011-07-13, with a file datestamp of 2011-05-08.
Experiment type: XRAY
Resolution: 2.75 Å
R-factor: 0.231
AEROSPACI score: 0.23 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Growth factor receptor-bound protein 2
    Species: Homo sapiens [TaxId:9606]
    Gene:
    Database cross-references and differences (RAF-indexed):
    • Uniprot P62993 (4-95)
      • cloning artifact (0-3)
    Domains in SCOPe 2.06: d1jyua1, d1jyua2
  • Heterogens: HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1jyuA (A:)
    gsmawffgkiprakaeemlskqrhdgafliresesapgdfslsvkfgndvqhfkvlrdga
    gkyflwvvkfnslnelvdyhrstsvsrnqqiflrdi