PDB entry 1jys

View 1jys on RCSB PDB site
Description: Crystal Structure of E. coli MTA/AdoHcy Nucleosidase
Class: hydrolase
Keywords: mixed alpha/beta, dimer, HYDROLASE
Deposited on 2001-09-13, released 2002-10-01
The last revision prior to the SCOPe 2.08 freeze date was dated 2009-02-24, with a file datestamp of 2009-03-01.
Experiment type: XRAY
Resolution: 1.9 Å
R-factor: 0.217
AEROSPACI score: 0.46 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: MTA/SAH nucleosidase
    Species: Escherichia coli [TaxId:562]
    Gene: pfs
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.08: d1jysa_
  • Chain 'B':
    Compound: MTA/SAH nucleosidase
    Species: Escherichia coli [TaxId:562]
    Gene: pfs
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.08: d1jysb_
  • Heterogens: ADE, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >1jysA (A:)
    fqgamdpefsmkigiigameeevtllrdkienrqtislggceiytgqlngtevallksgi
    gkvaaalgatlllehckpdviintgsagglaptlkvgdivvsdearyhdadvtafgyeyg
    qlpgcpagfkaddkliaaaeaciaelnlnavrglivsgdafingsvglakirhnfpqaia
    vemeataiahvchnfnvpfvvvraisdvadqqshlsfdeflavaakqsslmveslvqkla
    hg
    

    Sequence, based on observed residues (ATOM records): (download)
    >1jysA (A:)
    mkigiigameeevtllrdkienrqtislggceiytgqlngtevallksgigkvaaalgat
    lllehckpdviintgsagglaptlkvgdivvsdearyhdadvtafgyeygqlpgcpagfk
    addkliaaaeaciaelnlnavrglivsgdafingsvglakirhnfpqaiavemeataiah
    vchnfnvpfvvvraisdvadqsfdeflavaakqsslmveslvqkla
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >1jysB (B:)
    fqgamdpefsmkigiigameeevtllrdkienrqtislggceiytgqlngtevallksgi
    gkvaaalgatlllehckpdviintgsagglaptlkvgdivvsdearyhdadvtafgyeyg
    qlpgcpagfkaddkliaaaeaciaelnlnavrglivsgdafingsvglakirhnfpqaia
    vemeataiahvchnfnvpfvvvraisdvadqqshlsfdeflavaakqsslmveslvqkla
    hg
    

    Sequence, based on observed residues (ATOM records): (download)
    >1jysB (B:)
    mkigiigameeevtllrdkienrqtislggceiytgqlngtevallksgigkvaaalgat
    lllehckpdviintgsagglaptlkvgdivvsdearyhdadvtafgyeygqlpgcpagfk
    addkliaaaeaciaelnlnavrglivsgdafingsvglakirhnfpqaiavemeataiah
    vchnfnvpfvvvraisdvadqsfdeflavaakqsslmveslvqkla