PDB entry 1jyr

View 1jyr on RCSB PDB site
Description: xray structure of grb2 sh2 domain complexed with a phosphorylated peptide
Deposited on 2001-09-13, released 2002-03-13
The last revision prior to the SCOP 1.61 freeze date was dated 2002-03-13, with a file datestamp of 2002-03-13.
Experiment type: XRAY
Resolution: 1.55 Å
R-factor: 0.19
AEROSPACI score: 0.54 (click here for full SPACI score report)

Chains and heterogens:

• Chain 'A':
  Domains in SCOP 1.61: d1jyra_

PDB Chain Sequences:

• Chain 'A':
  Sequence; same for both SEQRES and ATOM records: (download)
  

  >1jyrA (A:)
  gsmawffgkiprakaeemlskqrhdgafliresesapgdfslsvkfgndvqhfkvlrdga
  gkyflwvvkfnslnelvdyhrstsvsrnqqiflrdi