PDB entry 1jyq

View 1jyq on RCSB PDB site
Description: Xray Structure of Grb2 SH2 Domain Complexed with a Highly Affine Phospho Peptide
Class: signaling protein/peptide inhibitor
Keywords: RECEPTOR BINDING, REGULATORY, SIGNALING PROTEIN-SIGNALING PROTEIN INHIBITOR, SIGNALING PROTEIN-PEPTIDE INHIBITOR complex
Deposited on 2001-09-13, released 2002-03-13
The last revision prior to the SCOPe 2.06 freeze date was dated 2011-07-13, with a file datestamp of 2011-05-08.
Experiment type: XRAY
Resolution: 2 Å
R-factor: 0.185
AEROSPACI score: 0.45 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Growth factor receptor-bound protein 2
    Species: Homo sapiens [TaxId:9606]
    Gene:
    Database cross-references and differences (RAF-indexed):
    • Uniprot P29354 (4-95)
      • cloning artifact (0-3)
    Domains in SCOPe 2.06: d1jyqa1, d1jyqa2
  • Chain 'B':
    Compound: Growth factor receptor-bound protein 2
    Species: Homo sapiens [TaxId:9606]
    Gene:
    Database cross-references and differences (RAF-indexed):
    • Uniprot P29354 (4-95)
      • cloning artifact (0-3)
    Domains in SCOPe 2.06: d1jyqb1, d1jyqb2
  • Chain 'H':
    Compound: mAZ-pY-(alpha Me)pY-N-NH2 peptide inhibitor
    Species: synthetic, synthetic
    Gene:
    Database cross-references and differences (RAF-indexed):
    • PDB 1JYQ (0-3)
  • Chain 'L':
    Compound: mAZ-pY-(alpha Me)pY-N-NH2 peptide inhibitor
    Species: synthetic, synthetic
    Gene:
    Database cross-references and differences (RAF-indexed):
    • PDB 1JYQ (0-3)
  • Heterogens: HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1jyqA (A:)
    gsmawffgkiprakaeemlskqrhdgafliresesapgdfslsvkfgndvqhfkvlrdga
    gkyflwvvkfnslnelvdyhrstsvsrnqqiflrdi
    

  • Chain 'B':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1jyqB (B:)
    gsmawffgkiprakaeemlskqrhdgafliresesapgdfslsvkfgndvqhfkvlrdga
    gkyflwvvkfnslnelvdyhrstsvsrnqqiflrdi
    

  • Chain 'H':
    No sequence available.

  • Chain 'L':
    No sequence available.