PDB entry 1jyq

View 1jyq on RCSB PDB site
Description:
Deposited on 2001-09-13, released 2002-03-13
The last revision prior to the SCOP 1.61 freeze date was dated 2002-03-13, with a file datestamp of 2002-03-13.
Experiment type: XRAY
Resolution: 2 Å
R-factor: 0.185
AEROSPACI score: 0.38 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound:
    Species:
    Gene:
    Domains in SCOP 1.61: d1jyqa_
  • Chain 'B':
    Compound:
    Species:
    Gene:
    Domains in SCOP 1.61: d1jyqb_

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1jyqA (A:)
    gsmawffgkiprakaeemlskqrhdgafliresesapgdfslsvkfgndvqhfkvlrdga
    gkyflwvvkfnslnelvdyhrstsvsrnqqiflrdi
    

  • Chain 'B':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1jyqB (B:)
    gsmawffgkiprakaeemlskqrhdgafliresesapgdfslsvkfgndvqhfkvlrdga
    gkyflwvvkfnslnelvdyhrstsvsrnqqiflrdi