PDB entry 1jyk

View 1jyk on RCSB PDB site
Description: Catalytic Mechanism of CTP:phosphocholine Cytidylytransferase from Streptococcus pneumoniae (LicC)
Class: transferase
Keywords: LicC, 3D Structure, CTP:phosphocholine cytidylyltransferase
Deposited on 2001-09-12, released 2002-02-22
The last revision prior to the SCOPe 2.06 freeze date was dated 2009-02-24, with a file datestamp of 2009-02-19.
Experiment type: XRAY
Resolution: 1.5 Å
R-factor: 0.218
AEROSPACI score: 0.57 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: CTP:phosphocholine Cytidylytransferase
    Species: Streptococcus pneumoniae [TaxId:1313]
    Gene: LicC
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q97QE9 (26-End)
      • expression tag (22-25)
      • conflict (41)
      • cloning artifact (133)
      • cloning artifact (213)
    Domains in SCOPe 2.06: d1jyka1, d1jyka2
  • Heterogens: HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >1jykA (A:)
    mgsshhhhhhssglvprgshmkeirvkaiilaaglgtrlrpltentpkalvqvnqkplie
    yqieflkekgindiiiivgylkeqfdylkekygvrlvfndkyadynnfyslylvkeelan
    syvidadnylfknmfrndltrstyfsvyredctnewflvygddykvqdiivdskagrils
    gvsfwdaptaekivsfidkayvsgefvdlywdnmvkdnikeldvyveelegnsiyeidsv
    qdyrkleeilknen
    

    Sequence, based on observed residues (ATOM records): (download)
    >1jykA (A:)
    eirvkaiilaaglgtrlrpltentpkalvqvnqkplieyqieflkekgindiiiivgylk
    eqfdylkekygvrlvfndkyadynnfyslylvkeelansyvidadnylfknmfrndltrs
    tyfsvyredctnewflvygddykvqdiivdskagrilsgvsfwdaptaekivsfidkayv
    sgefvdlywdnmvkdnikeldvyveelegnsiyeidsvqdyrkleeilk