PDB entry 1jye

View 1jye on RCSB PDB site
Description: structure of a dimeric lac repressor with c-terminal deletion and k84l substitution
Deposited on 2001-09-12, released 2001-10-18
The last revision prior to the SCOP 1.61 freeze date was dated 2001-10-18, with a file datestamp of 2001-10-18.
Experiment type: XRAY
Resolution: 1.7 Å
R-factor: 0.223
AEROSPACI score: 0.52 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Domains in SCOP 1.61: d1jyea_

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1jyeA (A:)
    lligvatsslalhapsqivaailsradqlgasvvvsmversgveacktavhnllaqrvsg
    liinyplddqdaiaveaactnvpalfldvsdqtpinsiifshedgtrlgvehlvalghqq
    iallagplssvsarlrlagwhkyltrnqiqpiaeregdwsamsgfqqtmqmlnegivpta
    mlvandqmalgamraitesglrvgadisvvgyddtedsscyipplttikqdfrllgqtsv
    drllqlsqgqavkgnqllpvslvkrkttlap