PDB entry 1jy3

View 1jy3 on RCSB PDB site
Description: crystal structure of the central region of bovine fibrinogen (e5 fragment) at 1.4 angstroms resolution
Deposited on 2001-09-10, released 2001-10-17
The last revision prior to the SCOP 1.59 freeze date was dated 2001-10-17, with a file datestamp of 2001-10-17.
Experiment type: XRAY
Resolution: 1.6 Å
R-factor: 0.194
AEROSPACI score: 0.61 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'N':
    Domains in SCOP 1.59: d1jy3n_
  • Chain 'O':
    Domains in SCOP 1.59: d1jy3o_
  • Chain 'P':
    Domains in SCOP 1.59: d1jy3p_
  • Chain 'Q':
    Domains in SCOP 1.59: d1jy3q_
  • Chain 'R':
    Domains in SCOP 1.59: d1jy3r_
  • Chain 'S':
    Domains in SCOP 1.59: d1jy3s_

PDB Chain Sequences:

  • Chain 'N':
    Sequence; same for both SEQRES and ATOM records: (download) 
    >1jy3N (N:)
gwpfcsdedwntkcpsgcrmkglidevdqdftsrinklrdslfn

  • Chain 'O':
    Sequence; same for both SEQRES and ATOM records: (download) 
    >1jy3O (O:)
rkppdadgclhadpdlgvlcptgcklqdtlvrqerpirksiedlrntvdsv

  • Chain 'P':
    Sequence; same for both SEQRES and ATOM records: (download) 
    >1jy3P (P:)
vatrdnccilderfgsycpttcgiadflnnyqtsvdkdlrtlegil

  • Chain 'Q':
    Sequence; same for both SEQRES and ATOM records: (download) 
    >1jy3Q (Q:)
gwpfcsdedwntkcpsgcrmkglidevdqdftsrinklrdslfn

  • Chain 'R':
    Sequence; same for both SEQRES and ATOM records: (download) 
    >1jy3R (R:)
rkppdadgclhadpdlgvlcptgcklqdtlvrqerpirksiedlrntvdsv

  • Chain 'S':
    Sequence; same for both SEQRES and ATOM records: (download) 
    >1jy3S (S:)
vatrdnccilderfgsycpttcgiadflnnyqtsvdkdlrtlegily