PDB entry 1jy2

View 1jy2 on RCSB PDB site
Description: Crystal Structure of the Central Region of Bovine Fibrinogen (E5 fragment) at 1.4 Angstroms Resolution
Class: blood clotting
Keywords: fibrinogen, fragment E, disulfide bonds, asymmetry, coiled-coil, beta-sheet, BLOOD CLOTTING
Deposited on 2001-09-10, released 2001-10-17
The last revision prior to the SCOPe 2.08 freeze date was dated 2017-10-04, with a file datestamp of 2017-09-29.
Experiment type: XRAY
Resolution: 1.4 Å
R-factor: N/A
AEROSPACI score: 0.54 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'N':
    Compound: fibrinogen alpha chain
    Species: Bos taurus [TaxId:9913]
    Database cross-references and differences (RAF-indexed):
    • PDB 1JY2
    Domains in SCOPe 2.08: d1jy2n_
  • Chain 'O':
    Compound: fibrinogen beta chain
    Species: Bos taurus [TaxId:9913]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.08: d1jy2o_
  • Chain 'P':
    Compound: fibrinogen gamma-b chain
    Species: Bos taurus [TaxId:9913]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.08: d1jy2p_
  • Chain 'Q':
    Compound: fibrinogen alpha chain
    Species: Bos taurus [TaxId:9913]
    Database cross-references and differences (RAF-indexed):
    • PDB 1JY2
    Domains in SCOPe 2.08: d1jy2q_
  • Chain 'R':
    Compound: fibrinogen beta chain
    Species: Bos taurus [TaxId:9913]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.08: d1jy2r_
  • Chain 'S':
    Compound: fibrinogen gamma-b chain
    Species: Bos taurus [TaxId:9913]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.08: d1jy2s_
  • Heterogens: HOH

PDB Chain Sequences:

  • Chain 'N':
    Sequence, based on SEQRES records: (download)
    >1jy2N (N:)
    sacketgwpfcsdedwntkcpsgcrmkglidevdqdftsrinklrdslfnyqk
    

    Sequence, based on observed residues (ATOM records): (download)
    >1jy2N (N:)
    gwpfcsdedwntkcpsgcrmkglidevdqdftsrinklrdslf
    

  • Chain 'O':
    Sequence, based on SEQRES records: (download)
    >1jy2O (O:)
    kverkppdadgclhadpdlgvlcptgcklqdtlvrqerpirksiedlrntvdsvsr
    

    Sequence, based on observed residues (ATOM records): (download)
    >1jy2O (O:)
    rkppdadgclhadpdlgvlcptgcklqdtlvrqerpirksiedlrntvdsv
    

  • Chain 'P':
    Sequence, based on SEQRES records: (download)
    >1jy2P (P:)
    yvatrdnccilderfgsycpttcgiadflnnyqtsvdkdlrtlegily
    

    Sequence, based on observed residues (ATOM records): (download)
    >1jy2P (P:)
    rdnccilderfgsycpttcgiadflnnyqtsvdkdlrtlegily
    

  • Chain 'Q':
    Sequence, based on SEQRES records: (download)
    >1jy2Q (Q:)
    sacketgwpfcsdedwntkcpsgcrmkglidevdqdftsrinklrdslfnyqk
    

    Sequence, based on observed residues (ATOM records): (download)
    >1jy2Q (Q:)
    gwpfcsdedwntkcpsgcrmkglidevdqdftsrinklrdslf
    

  • Chain 'R':
    Sequence, based on SEQRES records: (download)
    >1jy2R (R:)
    kverkppdadgclhadpdlgvlcptgcklqdtlvrqerpirksiedlrntvdsvsr
    

    Sequence, based on observed residues (ATOM records): (download)
    >1jy2R (R:)
    rkppdadgclhadpdlgvlcptgcklqdtlvrqerpirksiedlrntvds
    

  • Chain 'S':
    Sequence, based on SEQRES records: (download)
    >1jy2S (S:)
    yvatrdnccilderfgsycpttcgiadflnnyqtsvdkdlrtlegily
    

    Sequence, based on observed residues (ATOM records): (download)
    >1jy2S (S:)
    vatrdnccilderfgsycpttcgiadflnnyqtsvdkdlrtlegily