PDB entry 1jy1

View 1jy1 on RCSB PDB site
Description: crystal structure of human tyrosyl-DNA phosphodiesterase (tdp1)
Class: hydrolase
Keywords: PLD Superfamily, HYDROLASE
Deposited on 2001-09-10, released 2002-02-20
The last revision prior to the SCOPe 2.06 freeze date was dated 2009-02-24, with a file datestamp of 2009-02-03.
Experiment type: XRAY
Resolution: 1.69 Å
R-factor: 0.198
AEROSPACI score: 0.53 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: tyrosyl-DNA phosphodiesterase
    Species: Homo sapiens [TaxId:9606]
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q9NUW8 (4-463)
      • expression tag (0-3)
      • modified residue (12)
      • modified residue (121-122)
      • engineered (177)
      • engineered (183)
      • modified residue (275)
      • modified residue (346)
      • modified residue (353)
      • modified residue (388)
      • engineered (403)
      • modified residue (459)
    Domains in SCOPe 2.06: d1jy1a1, d1jy1a2, d1jy1a3
  • Heterogens: HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >1jy1A (A:)
    ledpgegqdiwdmldkgnpfqfyltrvsgvkpkynsgalhikdilsplfgtlvssaqfny
    cfdvdwlvkqyppefrkkpillvhgdkreakahlhaqakpyenislcqakldiafgthht
    kmmlllyeeglrvvihtsnlihadwhqktqgiwlsplypriadgthksgespthfkanli
    syltaynapslkewidvihkhdlsetnvyligstpgrfqgsqkdnwghfrlkkllkdhas
    smpnaeswpvvgqfssvgslgadeskwlcsefkesmltlgkesktpgkssvplyliypsv
    envrtslegypaggslpysiqtaekqnwlhsyfhkwsaetsgrsnamphiktymrpspdf
    skiawflvtsanlskaawgalekngtqlmirsyelgvlflpsalgldsfkvkqkffagsq
    epmatfpvpydlppelygskdrpwiwnipyvkapdthgnmwvps
    

    Sequence, based on observed residues (ATOM records): (download)
    >1jy1A (A:)
    ledpgegqdiwdmldkgnpfqfyltrvsgvkpkynsgalhikdilsplfgtlvssaqfny
    cfdvdwlvkqyppefrkkpillvhgdkreakahlhaqakpyenislcqakldiafgthht
    kmmlllyeeglrvvihtsnlihadwhqktqgiwlsplypriadgthksgespthfkanli
    syltaynapslkewidvihkhdlsetnvyligstpgrfqgsqkdnwghfrlkkllkdhaa
    eswpvvgqfssvgslgadeskwlcsefkesmltlgsvplyliypsvenvrtslegypagg
    slpysiqtaekqnwlhsyfhkwsaetsgrsnamphiktymrpspdfskiawflvtsanls
    kaawgalekngtqlmirsyelgvlflpsalgldsfkvkatfpvpydlppelygskdrpwi
    wnipyvkapdthgnmwvps