PDB entry 1jxz

View 1jxz on RCSB PDB site
Description: Structure of the H90Q mutant of 4-Chlorobenzoyl-Coenzyme A Dehalogenase complexed with 4-hydroxybenzoyl-Coenzyme A (product)
Class: hydrolase
Keywords: dehalogenase, coenzyme-A, HYDROLASE
Deposited on 2001-09-10, released 2001-10-03
The last revision prior to the SCOPe 2.05 freeze date was dated 2009-02-24, with a file datestamp of 2009-03-01.
Experiment type: XRAY
Resolution: 1.9 Å
R-factor: 0.195
AEROSPACI score: 0.45 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: 4-chlorobenzoyl Coenzyme A dehalogenase
    Species: Pseudomonas sp. CBS3 [TaxId:72586]
    Database cross-references and differences (RAF-indexed):
    • PIR 419529 (Start-268)
      • conflict (84)
      • engineered (89)
    Domains in SCOPe 2.05: d1jxza_
  • Chain 'B':
    Compound: 4-chlorobenzoyl Coenzyme A dehalogenase
    Species: Pseudomonas sp. CBS3 [TaxId:72586]
    Database cross-references and differences (RAF-indexed):
    • PIR 419529 (0-268)
      • conflict (84)
      • engineered (89)
    Domains in SCOPe 2.05: d1jxzb_
  • Chain 'C':
    Compound: 4-chlorobenzoyl Coenzyme A dehalogenase
    Species: Pseudomonas sp. CBS3 [TaxId:72586]
    Database cross-references and differences (RAF-indexed):
    • PIR 419529 (0-268)
      • conflict (84)
      • engineered (89)
    Domains in SCOPe 2.05: d1jxzc_
  • Heterogens: CA, PO4, BCA, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >1jxzA (A:)
    myeaighrvedgvaeitiklprhrnalsvkamqevtdalnraeeddsvgavmitgaedaf
    cagfylreipldkgvagvrdhfriaalwwqqmihkiirvkrpvlaaingvaaggglgisl
    asdmaicadsakfvcawhtigigndtatsyslarivgmrramelmltnrtlypeeakdwg
    lvsrvypkdefrevawkvarelaaapthlqvmakerfhagwmqpveectefeiqnviasv
    thphfmpcltrfldghradrpqvelpagv
    

    Sequence, based on observed residues (ATOM records): (download)
    >1jxzA (A:)
    yeaighrvedgvaeitiklprhrnalsvkamqevtdalnraeeddsvgavmitgaedafc
    agfylreipldkgvagvrdhfriaalwwqqmihkiirvkrpvlaaingvaaggglgisla
    sdmaicadsakfvcawhtigigndtatsyslarivgmrramelmltnrtlypeeakdwgl
    vsrvypkdefrevawkvarelaaapthlqvmakerfhagwmqpveectefeiqnviasvt
    hphfmpcltrfldghradrpqvelpagv
    

  • Chain 'B':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1jxzB (B:)
    myeaighrvedgvaeitiklprhrnalsvkamqevtdalnraeeddsvgavmitgaedaf
    cagfylreipldkgvagvrdhfriaalwwqqmihkiirvkrpvlaaingvaaggglgisl
    asdmaicadsakfvcawhtigigndtatsyslarivgmrramelmltnrtlypeeakdwg
    lvsrvypkdefrevawkvarelaaapthlqvmakerfhagwmqpveectefeiqnviasv
    thphfmpcltrfldghradrpqvelpagv
    

  • Chain 'C':
    Sequence, based on SEQRES records: (download)
    >1jxzC (C:)
    myeaighrvedgvaeitiklprhrnalsvkamqevtdalnraeeddsvgavmitgaedaf
    cagfylreipldkgvagvrdhfriaalwwqqmihkiirvkrpvlaaingvaaggglgisl
    asdmaicadsakfvcawhtigigndtatsyslarivgmrramelmltnrtlypeeakdwg
    lvsrvypkdefrevawkvarelaaapthlqvmakerfhagwmqpveectefeiqnviasv
    thphfmpcltrfldghradrpqvelpagv
    

    Sequence, based on observed residues (ATOM records): (download)
    >1jxzC (C:)
    myeaighrvedgvaeitiklprhrnalsvkamqevtdalnraeeddsvgavmitgaedaf
    cagfylreipldkgvagvrdhfriaalwwqqmihkiirvkrpvlaaingvaaggglgisl
    asdmaicadsakfvcawhtigigndtatsyslarivgmrramelmltnrtlypeeakdwg
    lvsrvypkdefrevawkvarelaaapthlqvmakerfhagwmqpveectefeiqnviasv
    thphfmpcltrfldgpqvelpagv