PDB entry 1jxv

View 1jxv on RCSB PDB site
Description: Crystal Structure of Human Nucleoside Diphosphate Kinase A
Deposited on 2001-09-10, released 2002-04-10
The last revision prior to the SCOP 1.63 freeze date was dated 2002-04-10, with a file datestamp of 2002-04-10.
Experiment type: XRAY
Resolution: 2.2 Å
R-factor: 0.207
AEROSPACI score: 0.31 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Domains in SCOP 1.63: d1jxva_
  • Chain 'B':
    Domains in SCOP 1.63: d1jxvb_
  • Chain 'C':
    Domains in SCOP 1.63: d1jxvc_
  • Chain 'D':
    Domains in SCOP 1.63: d1jxvd_
  • Chain 'E':
    Domains in SCOP 1.63: d1jxve_
  • Chain 'F':
    Domains in SCOP 1.63: d1jxvf_

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1jxvA (A:)
    certfiaikpdgvqrglvgeiikrfeqkgfrlvglkfmqasedllkehyvdlkdrpffag
    lvkymhsgpvvamvweglnvvktgrvmlgetnpadskpgtirgdfciqvgrniihgsdsv
    esaekeiglwfhpeelvdytscaqnwiye
    

  • Chain 'B':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1jxvB (B:)
    certfiaikpdgvqrglvgeiikrfeqkgfrlvglkfmqasedllkehyvdlkdrpffag
    lvkymhsgpvvamvweglnvvktgrvmlgetnpadskpgtirgdfciqvgrniihgsdsv
    esaekeiglwfhpeelvdytscaqnwiye
    

  • Chain 'C':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1jxvC (C:)
    certfiaikpdgvqrglvgeiikrfeqkgfrlvglkfmqasedllkehyvdlkdrpffag
    lvkymhsgpvvamvweglnvvktgrvmlgetnpadskpgtirgdfciqvgrniihgsdsv
    esaekeiglwfhpeelvdytscaqnwiye
    

  • Chain 'D':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1jxvD (D:)
    certfiaikpdgvqrglvgeiikrfeqkgfrlvglkfmqasedllkehyvdlkdrpffag
    lvkymhsgpvvamvweglnvvktgrvmlgetnpadskpgtirgdfciqvgrniihgsdsv
    esaekeiglwfhpeelvdytscaqnwiye
    

  • Chain 'E':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1jxvE (E:)
    certfiaikpdgvqrglvgeiikrfeqkgfrlvglkfmqasedllkehyvdlkdrpffag
    lvkymhsgpvvamvweglnvvktgrvmlgetnpadskpgtirgdfciqvgrniihgsdsv
    esaekeiglwfhpeelvdytscaqnwiye
    

  • Chain 'F':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1jxvF (F:)
    certfiaikpdgvqrglvgeiikrfeqkgfrlvglkfmqasedllkehyvdlkdrpffag
    lvkymhsgpvvamvweglnvvktgrvmlgetnpadskpgtirgdfciqvgrniihgsdsv
    esaekeiglwfhpeelvdytscaqnwiye