PDB entry 1jxv

View 1jxv on RCSB PDB site
Description: Crystal Structure of Human Nucleoside Diphosphate Kinase A
Class: transferase
Keywords: transferase, kinase
Deposited on 2001-09-10, released 2002-04-10
The last revision prior to the SCOPe 2.07 freeze date was dated 2009-02-24, with a file datestamp of 2009-02-03.
Experiment type: XRAY
Resolution: 2.2 Å
R-factor: 0.207
AEROSPACI score: 0.37 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Nucleoside Diphosphate Kinase A
    Species: Homo sapiens [TaxId:9606]
    Gene: nm23-H1
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d1jxva_
  • Chain 'B':
    Compound: Nucleoside Diphosphate Kinase A
    Species: Homo sapiens [TaxId:9606]
    Gene: nm23-H1
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d1jxvb_
  • Chain 'C':
    Compound: Nucleoside Diphosphate Kinase A
    Species: Homo sapiens [TaxId:9606]
    Gene: nm23-H1
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d1jxvc_
  • Chain 'D':
    Compound: Nucleoside Diphosphate Kinase A
    Species: Homo sapiens [TaxId:9606]
    Gene: nm23-H1
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d1jxvd_
  • Chain 'E':
    Compound: Nucleoside Diphosphate Kinase A
    Species: Homo sapiens [TaxId:9606]
    Gene: nm23-H1
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d1jxve_
  • Chain 'F':
    Compound: Nucleoside Diphosphate Kinase A
    Species: Homo sapiens [TaxId:9606]
    Gene: nm23-H1
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d1jxvf_
  • Heterogens: HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >1jxvA (A:)
    mancertfiaikpdgvqrglvgeiikrfeqkgfrlvglkfmqasedllkehyvdlkdrpf
    faglvkymhsgpvvamvweglnvvktgrvmlgetnpadskpgtirgdfciqvgrniihgs
    dsvesaekeiglwfhpeelvdytscaqnwiye
    

    Sequence, based on observed residues (ATOM records): (download)
    >1jxvA (A:)
    certfiaikpdgvqrglvgeiikrfeqkgfrlvglkfmqasedllkehyvdlkdrpffag
    lvkymhsgpvvamvweglnvvktgrvmlgetnpadskpgtirgdfciqvgrniihgsdsv
    esaekeiglwfhpeelvdytscaqnwiye
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >1jxvB (B:)
    mancertfiaikpdgvqrglvgeiikrfeqkgfrlvglkfmqasedllkehyvdlkdrpf
    faglvkymhsgpvvamvweglnvvktgrvmlgetnpadskpgtirgdfciqvgrniihgs
    dsvesaekeiglwfhpeelvdytscaqnwiye
    

    Sequence, based on observed residues (ATOM records): (download)
    >1jxvB (B:)
    certfiaikpdgvqrglvgeiikrfeqkgfrlvglkfmqasedllkehyvdlkdrpffag
    lvkymhsgpvvamvweglnvvktgrvmlgetnpadskpgtirgdfciqvgrniihgsdsv
    esaekeiglwfhpeelvdytscaqnwiye
    

  • Chain 'C':
    Sequence, based on SEQRES records: (download)
    >1jxvC (C:)
    mancertfiaikpdgvqrglvgeiikrfeqkgfrlvglkfmqasedllkehyvdlkdrpf
    faglvkymhsgpvvamvweglnvvktgrvmlgetnpadskpgtirgdfciqvgrniihgs
    dsvesaekeiglwfhpeelvdytscaqnwiye
    

    Sequence, based on observed residues (ATOM records): (download)
    >1jxvC (C:)
    certfiaikpdgvqrglvgeiikrfeqkgfrlvglkfmqasedllkehyvdlkdrpffag
    lvkymhsgpvvamvweglnvvktgrvmlgetnpadskpgtirgdfciqvgrniihgsdsv
    esaekeiglwfhpeelvdytscaqnwiye
    

  • Chain 'D':
    Sequence, based on SEQRES records: (download)
    >1jxvD (D:)
    mancertfiaikpdgvqrglvgeiikrfeqkgfrlvglkfmqasedllkehyvdlkdrpf
    faglvkymhsgpvvamvweglnvvktgrvmlgetnpadskpgtirgdfciqvgrniihgs
    dsvesaekeiglwfhpeelvdytscaqnwiye
    

    Sequence, based on observed residues (ATOM records): (download)
    >1jxvD (D:)
    certfiaikpdgvqrglvgeiikrfeqkgfrlvglkfmqasedllkehyvdlkdrpffag
    lvkymhsgpvvamvweglnvvktgrvmlgetnpadskpgtirgdfciqvgrniihgsdsv
    esaekeiglwfhpeelvdytscaqnwiye
    

  • Chain 'E':
    Sequence, based on SEQRES records: (download)
    >1jxvE (E:)
    mancertfiaikpdgvqrglvgeiikrfeqkgfrlvglkfmqasedllkehyvdlkdrpf
    faglvkymhsgpvvamvweglnvvktgrvmlgetnpadskpgtirgdfciqvgrniihgs
    dsvesaekeiglwfhpeelvdytscaqnwiye
    

    Sequence, based on observed residues (ATOM records): (download)
    >1jxvE (E:)
    certfiaikpdgvqrglvgeiikrfeqkgfrlvglkfmqasedllkehyvdlkdrpffag
    lvkymhsgpvvamvweglnvvktgrvmlgetnpadskpgtirgdfciqvgrniihgsdsv
    esaekeiglwfhpeelvdytscaqnwiye
    

  • Chain 'F':
    Sequence, based on SEQRES records: (download)
    >1jxvF (F:)
    mancertfiaikpdgvqrglvgeiikrfeqkgfrlvglkfmqasedllkehyvdlkdrpf
    faglvkymhsgpvvamvweglnvvktgrvmlgetnpadskpgtirgdfciqvgrniihgs
    dsvesaekeiglwfhpeelvdytscaqnwiye
    

    Sequence, based on observed residues (ATOM records): (download)
    >1jxvF (F:)
    certfiaikpdgvqrglvgeiikrfeqkgfrlvglkfmqasedllkehyvdlkdrpffag
    lvkymhsgpvvamvweglnvvktgrvmlgetnpadskpgtirgdfciqvgrniihgsdsv
    esaekeiglwfhpeelvdytscaqnwiye