PDB entry 1jxo

View 1jxo on RCSB PDB site
Description: Crystal Structure of the SH3-HOOK-GK Fragment of PSD-95
Class: structural protein
Keywords: MAGUK, postsynaptic density, SH3 domain, guanylate kinase domain, structural protein
Deposited on 2001-09-07, released 2002-01-16
The last revision prior to the SCOPe 2.01 freeze date was dated 2009-02-24, with a file datestamp of 2009-02-03.
Experiment type: XRAY
Resolution: 2.3 Å
R-factor: 0.22
AEROSPACI score: 0.36 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: postsynaptic density protein
    Species: Rattus norvegicus [TaxId:10116]
    Gene: PSD-95
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.01: d1jxoa1, d1jxoa2
  • Chain 'B':
    Compound: postsynaptic density protein
    Species: Rattus norvegicus [TaxId:10116]
    Gene: PSD-95
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.01: d1jxob1, d1jxob2
  • Heterogens: HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >1jxoA (A:)
    gshmasgfyiralfdydktkdcgflsqalsfrfgdvlhvidagdeewwqarrvhsdsetd
    digfipskrrverrewsrlkakdwgsssgsqgredsvlsyetvtqmevhyarpiiilgpt
    kdranddllsefpdkfgscvphttrpkreyeidgrdyhfvssrekmekdiqahkfieagq
    ynshlygtsvqsvrevaeqgkhcildvsanavrrlqaahlhpiaifirprslenvleink
    riteeqarkafdratkleqeftecfsaivegdsfeeiyhkvkrviedlsgpyiwvparer
    l
    

    Sequence, based on observed residues (ATOM records): (download)
    >1jxoA (A:)
    gfyiralfdydktkdcgflsqalsfrfgdvlhvidagdeewwqarrvigfipskrrverr
    ewsrlkakdwgvlsyetvtqmevhyarpiiilgptkdranddllsefpdkfgscvphttr
    rdyhfvssrekmekdiqahkfieagqshlygtsvqsvrevaeqgkhcildvsanavrrlq
    aahlhpiaifirprslenvleinkriteeqarkafdratkleqeftecfsaivegdsfee
    iyhkvkrviedlsgpyiwvpa
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >1jxoB (B:)
    gshmasgfyiralfdydktkdcgflsqalsfrfgdvlhvidagdeewwqarrvhsdsetd
    digfipskrrverrewsrlkakdwgsssgsqgredsvlsyetvtqmevhyarpiiilgpt
    kdranddllsefpdkfgscvphttrpkreyeidgrdyhfvssrekmekdiqahkfieagq
    ynshlygtsvqsvrevaeqgkhcildvsanavrrlqaahlhpiaifirprslenvleink
    riteeqarkafdratkleqeftecfsaivegdsfeeiyhkvkrviedlsgpyiwvparer
    l
    

    Sequence, based on observed residues (ATOM records): (download)
    >1jxoB (B:)
    gfyiralfdydktkdcgflsqalsfrfgdvlhvidagdeewwqarrvhigfipskrrver
    rewsrlkakdwgvlsyetvtqmevhyarpiiilgptkdranddllsefpdkfgscvphtt
    rdgrdyhfvssrekmekdiqahkfieagqshlygtsvqsvrevaeqgkhcildvsanavr
    rlqaahlhpiaifirprslenvleinkriteeqarkafdratkleqeftecfsaivegds
    feeiyhkvkrviedlsgpyiwvpa