PDB entry 1jxn

View 1jxn on RCSB PDB site
Description: Crystal Structure of the Lectin I from Ulex europaeus in complex with the methyl glycoside of alpha-L-fucose
Deposited on 2001-09-07, released 2002-12-06
The last revision prior to the SCOP 1.67 freeze date was dated 2002-12-06, with a file datestamp of 2002-12-06.
Experiment type: XRAY
Resolution: 2.3 Å
R-factor: 0.202
AEROSPACI score: 0.33 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Domains in SCOP 1.67: d1jxna_
  • Chain 'B':
    Domains in SCOP 1.67: d1jxnb_
  • Chain 'C':
    Domains in SCOP 1.67: d1jxnc_
  • Chain 'D':
    Domains in SCOP 1.67: d1jxnd_

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >1jxnA (A:)
    sddlsfkfknfsqngkdlsfqgnasvietgvlqlnkvgnnlpdetggiaryiapihiwnc
    ntgelasfitsfsffmetsanpkaatdgltfflappdsplrraggyfglfndtkcdssyq
    tvavefdtigspvnfwdpgfphigidvncvksinaerwnkryglnnvanveiiyeasskt
    ltasltypsdqtsisvtsivdlkeilpewvsvgfsgstyigrqathevlnwyftstfint
    ns
    

    Sequence, based on observed residues (ATOM records): (download)
    >1jxnA (A:)
    sddlsfkfknfsqngkdlsfqgnasvietgvlqlnkvgnnlpdetggiaryiapihiwnc
    ntgelasfitsfsffmetsanpkaatdgltfflappdsplrraggyfglfndtkcdssyq
    tvavefdtigspvnfwdpgfphigidvncvksinaerwnkryglnnvanveiiyeasskt
    ltasltypsdqtsisvtsivdlkeilpewvsvgfsgstyigrqathevlnwyftstfint
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >1jxnB (B:)
    sddlsfkfknfsqngkdlsfqgnasvietgvlqlnkvgnnlpdetggiaryiapihiwnc
    ntgelasfitsfsffmetsanpkaatdgltfflappdsplrraggyfglfndtkcdssyq
    tvavefdtigspvnfwdpgfphigidvncvksinaerwnkryglnnvanveiiyeasskt
    ltasltypsdqtsisvtsivdlkeilpewvsvgfsgstyigrqathevlnwyftstfint
    ns
    

    Sequence, based on observed residues (ATOM records): (download)
    >1jxnB (B:)
    sddlsfkfknfsqngkdlsfqgnasvietgvlqlnkvgnnlpdetggiaryiapihiwnc
    ntgelasfitsfsffmetsanpkaatdgltfflappdsplrraggyfglfndtkcdssyq
    tvavefdtigspvnfwdpgfphigidvncvksinaerwnkryglnnvanveiiyeasskt
    ltasltypsdqtsisvtsivdlkeilpewvsvgfsgstyigrqathevlnwyftstfint
    

  • Chain 'C':
    Sequence, based on SEQRES records: (download)
    >1jxnC (C:)
    sddlsfkfknfsqngkdlsfqgnasvietgvlqlnkvgnnlpdetggiaryiapihiwnc
    ntgelasfitsfsffmetsanpkaatdgltfflappdsplrraggyfglfndtkcdssyq
    tvavefdtigspvnfwdpgfphigidvncvksinaerwnkryglnnvanveiiyeasskt
    ltasltypsdqtsisvtsivdlkeilpewvsvgfsgstyigrqathevlnwyftstfint
    ns
    

    Sequence, based on observed residues (ATOM records): (download)
    >1jxnC (C:)
    sddlsfkfknfsqngkdlsfqgnasvietgvlqlnkvgnnlpdetggiaryiapihiwnc
    ntgelasfitsfsffmetsanpkaatdgltfflappdsplrraggyfglfndtkcdssyq
    tvavefdtigspvnfwdpgfphigidvncvksinaerwnkryglnnvanveiiyeasskt
    ltasltypsdqtsisvtsivdlkeilpewvsvgfsgstyigrqathevlnwyftstfint
    

  • Chain 'D':
    Sequence, based on SEQRES records: (download)
    >1jxnD (D:)
    sddlsfkfknfsqngkdlsfqgnasvietgvlqlnkvgnnlpdetggiaryiapihiwnc
    ntgelasfitsfsffmetsanpkaatdgltfflappdsplrraggyfglfndtkcdssyq
    tvavefdtigspvnfwdpgfphigidvncvksinaerwnkryglnnvanveiiyeasskt
    ltasltypsdqtsisvtsivdlkeilpewvsvgfsgstyigrqathevlnwyftstfint
    ns
    

    Sequence, based on observed residues (ATOM records): (download)
    >1jxnD (D:)
    sddlsfkfknfsqngkdlsfqgnasvietgvlqlnkvgnnlpdetggiaryiapihiwnc
    ntgelasfitsfsffmetsanpkaatdgltfflappdsplrraggyfglfndtkcdssyq
    tvavefdtigspvnfwdpgfphigidvncvksinaerwnkryglnnvanveiiyeasskt
    ltasltypsdqtsisvtsivdlkeilpewvsvgfsgstyigrqathevlnwyftstfin