PDB entry 1jxm

View 1jxm on RCSB PDB site
Description: crystal structure of the gmp bound sh3-hook-gk fragment of psd-95
Class: structural protein
Keywords: MAGUK, postsynaptic density, SH3 domain, guanylate kinase domain, STRUCTURAL PROTEIN
Deposited on 2001-09-07, released 2002-01-16
The last revision prior to the SCOPe 2.07 freeze date was dated 2011-06-22, with a file datestamp of 2011-06-17.
Experiment type: XRAY
Resolution: 2 Å
R-factor: 0.237
AEROSPACI score: 0.41 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: postsynaptic density protein
    Species: Rattus norvegicus [TaxId:10116]
    Gene: PSD-95
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d1jxma1, d1jxma2
  • Heterogens: 5GP, GAI, MPD, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >1jxmA (A:)
    gshmasgfyiralfdydktkdcgflsqalsfrfgdvlhvidagdeewwqarrvhsdsetd
    digfipskrrverrewsrlkakdwgsssgsqgredsvlsyetvtqmevhyarpiiilgpt
    kdranddllsefpdkfgscvphttrpkreyeidgrdyhfvssrekmekdiqahkfieagq
    ynshlygtsvqsvrevaeqgkhcildvsanavrrlqaahlhpiaifirprslenvleink
    riteeqarkafdratkleqeftecfsaivegdsfeeiyhkvkrviedlsgpyiwvparer
    l
    

    Sequence, based on observed residues (ATOM records): (download)
    >1jxmA (A:)
    gfyiralfdycgflsqalsfrfgdvlhvidagdeewwqarrvgfipskrrverrewsrlv
    lsyetvtqmevhyarpiiilgptkdranddllsefpdkfgscvphttrpkreyeidgrdy
    hfvssrekmekdiqahkfieagqynshlygtsvqsvrevaeqgkhcildvsanavrrlqa
    ahlhpiaifirprslenvleinkriteeqarkafdratkleqeftecfsaivegdsfeei
    yhkvkrviedlsgpyiwvparerl