PDB entry 1jxk

View 1jxk on RCSB PDB site
Description: Role of ethe mobile loop in the mehanism of human salivary amylase
Class: hydrolase
Keywords: amylase, mutagenesis, catalysis, human, salivary, enzyme, mobile loop, HYDROLASE
Deposited on 2001-09-07, released 2001-09-14
The last revision prior to the SCOPe 2.08 freeze date was dated 2019-12-25, with a file datestamp of 2019-12-20.
Experiment type: XRAY
Resolution: 1.9 Å
R-factor: N/A
AEROSPACI score: 0.34 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Alpha-amylase, salivary
    Species: Homo sapiens [TaxId:9606]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.08: d1jxka1, d1jxka2
  • Heterogens: CA, CL, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1jxkA (A:)
    eyssntqqgrtsivhlfewrwvdialecerylapkgfggvqvsppnenvaihnpfrpwwe
    ryqpvsyklctrsgnedefrnmvtrcnnvgvriyvdavinhmcgnavsagtsstcgsyfn
    pgsrdfpavpysgwdfndgkcktgsgdienyndatqvrdcrlsglldlalgkdyvrskia
    eymnhlidigvagfridaskhmwpgdikaildklhnlnsnwfpegskpfiyqevidlgge
    pikssdyfgngrvtefkygaklgtvirkwngekmsylknwgegwgfmpsdralvfvdnhd
    nqrghsiltfwdarlykmavgfmlahpygftrvmssyrwpryfengkdvndwvgppndng
    vtkevtinpdttcgndwvcehrwrqirnmvnfrnvvdgqpftnwydngsnqvafgrgnrg
    fivfnnddwtfsltlqtglpagtycdvisgdkingnctgikiyvsddgkahfsisnsaed
    pfiaihaeskl