PDB entry 1jxj

View 1jxj on RCSB PDB site
Description: Role of mobile loop in the mechanism of human salivary amylase
Class: hydrolase
Keywords: amylase, mutagenesis, catalysis, human, salivary, enzyme, mobile loop, HYDROLASE
Deposited on 2001-09-07, released 2001-09-14
The last revision prior to the SCOPe 2.07 freeze date was dated 2017-10-04, with a file datestamp of 2017-09-29.
Experiment type: XRAY
Resolution: 1.99 Å
R-factor: N/A
AEROSPACI score: 0.31 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Alpha-amylase, salivary
    Species: Homo sapiens [TaxId:9606]
    Gene:
    Database cross-references and differences (RAF-indexed):
    • Uniprot P04745 (0-495)
      • modified residue (0)
      • engineered (57)
    Domains in SCOPe 2.07: d1jxja1, d1jxja2
  • Heterogens: CA, CL, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1jxjA (A:)
    eyssntqqgrtsivhlfewrwvdialecerylapkgfggvqvsppnenvaihnpfrplwe
    ryqpvsyklctrsgnedefrnmvtrcnnvgvriyvdavinhmcgnavsagtsstcgsyfn
    pgsrdfpavpysgwdfndgkcktgsgdienyndatqvrdcrlsglldlalgkdyvrskia
    eymnhlidigvagfridaskhmwpgdikaildklhnlnsnwfpegskpfiyqevidlgge
    pikssdyfgngrvtefkygaklgtvirkwngekmsylknwgegwgfmpsdralvfvdnhd
    nqrghgaggasiltfwdarlykmavgfmlahpygftrvmssyrwpryfengkdvndwvgp
    pndngvtkevtinpdttcgndwvcehrwrqirnmvnfrnvvdgqpftnwydngsnqvafg
    rgnrgfivfnnddwtfsltlqtglpagtycdvisgdkingnctgikiyvsddgkahfsis
    nsaedpfiaihaeskl