PDB entry 1jxe

View 1jxe on RCSB PDB site
Description: stoffel fragment of taq dna polymerase i
Deposited on 1996-10-09, released 1997-03-12
The last revision prior to the SCOP 1.55 freeze date was dated 1997-03-12, with a file datestamp of 1997-03-13.
Experiment type: XRAY
Resolution: 2.85 Å
R-factor: 0.207
AEROSPACI score: 0.27 (click here for full SPACI score report)

Chains and heterogens:

PDB Chain Sequences:

  • Chain ' ':
    Sequence, based on SEQRES records: (download)
    >1jxe_ (-)
    aleeapwpppegafvgfvlsrkepmwadllalaaarggrvhrapepykalrdlkeargll
    akdlsvlalreglglppgddpmllaylldpsnttpegvarryggewteeageraalserl
    fanlwgrlegeerllwlyreverplsavlahmeatgvrldvaylralslevaeeiarlea
    evfrlaghpfnlnsrdqlervlfdelglpaigktektgkrstsaavlealreahpiveki
    lqyreltklkstyidplpdlihprtgrlhtrfnqtatatgrlsssdpnlqnipvrtplgq
    rirrafiaeegwllvaldysqielrvlahlsgdenlirvfqegrdihtetaswmfgvpre
    avdplmrraaktinfgvlygmsahrlsqelaipyeeaqafieryfqsfpkvrawiektle
    egrrrgyvetlfgrrryvpdlearvksvreaaermafnmpvqgtaadlmklamvklfprl
    eemgarmllqvhdelvleapkeraeavarlakevmegvyplavplevevgigedwlsake
    

    Sequence, based on observed residues (ATOM records): (download)
    >1jxe_ (-)
    aleeapwpppegafvgfvlsrkepmwadllalaaarggrvhrapepykalrdlkeargll
    akdlsvlalreglglppgddpmllaylldpsnttpegvarryggewteeageraalserl
    fanlwgrlegeerllwlyreverplsavlahmeatgvrldvaylralslevaeeiarlea
    evfrlaghpfnlnsrdqlervlfdelglaavlealreahpivekilqyreltklkstyid
    plpdlihprtgrlhtrfnqtatatgrlsssdpnlqnipvrtplgqrirrafiaeegwllv
    aldysqielrvlahlsgdenlirvfqegrdihtetaswmfgvpreavdplmrraaktinf
    gvlygmsahrlsqelaipyeeaqafieryfqsfpkvrawiektleegrrrgyvetlfgrr
    ryvpdlearvksvreaaermafnmpvqgtaadlmklamvklfprleemgarmllqvhdel
    vleapkeraeavarlakevmegvyplavplevevgigedwlsake