PDB entry 1jxc

View 1jxc on RCSB PDB site
Description: Minimized NMR structure of ATT, an Arabidopsis trypsin/chymotrypsin inhibitor
Class: hydrolase inhibitor
Keywords: ATT, trypsin inhibitor, chymotrypsin inhibitor, Structural Genomics, Protein Structure Initiative, Center for Eukaryotic Structural Genomics, CESG, HYDROLASE INHIBITOR
Deposited on 2001-09-06, released 2003-01-07
The last revision prior to the SCOPe 2.04 freeze date was dated 2009-02-24, with a file datestamp of 2009-02-03.
Experiment type: NMR
Resolution: N/A
R-factor: N/A
AEROSPACI score: -0 (click here for full SPACI score report)

Chains and heterogens:

• Chain 'A':
  Compound: Putative trypsin inhibitor ATTI-2
  Species: Arabidopsis thaliana [TaxId:3702]
  Gene: ATTp
  Database cross-references and differences (RAF-indexed):
  • Uniprot Q42328 (0-67)
    • see remark 999 (0)
  Domains in SCOPe 2.04: d1jxca_

PDB Chain Sequences:

• Chain 'A':
  Sequence; same for both SEQRES and ATOM records: (download)
  

  >1jxcA (A:)
  cpeieaqgneclkeyggdvgfgfcaprifpticytrcrenkgakggrcrwgqgsnvkclc
  dfcgdtpq