PDB entry 1jxc

View 1jxc on RCSB PDB site
Description: Minimized NMR structure of ATT, an Arabidopsis trypsin/chymotrypsin inhibitor
Class: hydrolase inhibitor
Keywords: ATT, trypsin inhibitor, chymotrypsin inhibitor, Structural Genomics, Protein Structure Initiative, Center for Eukaryotic Structural Genomics, CESG, HYDROLASE INHIBITOR
Deposited on 2001-09-06, released 2003-01-07
The last revision prior to the SCOP 1.75 freeze date was dated 2008-02-12, with a file datestamp of 2008-02-08.
Experiment type: NMRAVE
Resolution: N/A
R-factor: N/A
AEROSPACI score: -0.07 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Putative trypsin inhibitor ATTI-2
    Species: Arabidopsis thaliana
    Gene: ATTp
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q42328 (0-67)
      • see remark 999 (0)
    Domains in SCOP 1.75: d1jxca_

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1jxcA (A:)
    cpeieaqgneclkeyggdvgfgfcaprifpticytrcrenkgakggrcrwgqgsnvkclc
    dfcgdtpq