PDB entry 1jxc

View 1jxc on RCSB PDB site
Description: minimized nmr structure of att, an arabidopsis trypsin/chymotrypsin inhibitor
Deposited on 2001-09-06, released 2003-01-07
The last revision prior to the SCOP 1.71 freeze date was dated 2003-01-07, with a file datestamp of 2003-01-07.
Experiment type: NMRAVE
Resolution: N/A
R-factor: N/A
AEROSPACI score: 0 (click here for full SPACI score report)

Chains and heterogens:

• Chain 'A':
  Domains in SCOP 1.71: d1jxca_

PDB Chain Sequences:

• Chain 'A':
  Sequence; same for both SEQRES and ATOM records: (download)
  

  >1jxcA (A:)
  cpeieaqgneclkeyggdvgfgfcaprifpticytrcrenkgakggrcrwgqgsnvkclc
  dfcgdtpq