PDB entry 1jx7

View 1jx7 on RCSB PDB site
Description: Crystal structure of ychN protein from E.coli
Class: structural genomics, unknown function
Keywords: NEW FOLD, HEXAMER, STRUCTURAL GENOMICS, BSGC structure funded by NIH, Protein Structure Initiative, PSI, Berkeley Structural Genomics Center, UNKNOWN FUNCTION
Deposited on 2001-09-05, released 2002-09-07
The last revision prior to the SCOPe 2.06 freeze date was dated 2009-02-24, with a file datestamp of 2009-02-19.
Experiment type: XRAY
Resolution: 2.8 Å
R-factor: 0.229
AEROSPACI score: 0.24 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: hypothetical protein ychn
    Species: Escherichia coli [TaxId:562]
    Gene:
    Database cross-references and differences (RAF-indexed):
    • Uniprot P0AB52
      • cloning artifact (0)
      • cloning artifact (41)
      • cloning artifact (63)
    Domains in SCOPe 2.06: d1jx7a1, d1jx7a2
  • Chain 'B':
    Compound: hypothetical protein ychn
    Species: Escherichia coli [TaxId:562]
    Gene:
    Database cross-references and differences (RAF-indexed):
    • Uniprot P0AB52
      • cloning artifact (0)
      • cloning artifact (41)
      • cloning artifact (63)
    Domains in SCOPe 2.06: d1jx7b1, d1jx7b2
  • Chain 'C':
    Compound: hypothetical protein ychn
    Species: Escherichia coli [TaxId:562]
    Gene:
    Database cross-references and differences (RAF-indexed):
    • Uniprot P0AB52
      • cloning artifact (0)
      • cloning artifact (41)
      • cloning artifact (63)
    Domains in SCOPe 2.06: d1jx7c1, d1jx7c2
  • Chain 'D':
    Compound: hypothetical protein ychn
    Species: Escherichia coli [TaxId:562]
    Gene:
    Database cross-references and differences (RAF-indexed):
    • Uniprot P0AB52
      • cloning artifact (0)
      • cloning artifact (41)
      • cloning artifact (63)
    Domains in SCOPe 2.06: d1jx7d1, d1jx7d2
  • Chain 'E':
    Compound: hypothetical protein ychn
    Species: Escherichia coli [TaxId:562]
    Gene:
    Database cross-references and differences (RAF-indexed):
    • Uniprot P0AB52
      • cloning artifact (0)
      • cloning artifact (41)
      • cloning artifact (63)
    Domains in SCOPe 2.06: d1jx7e1, d1jx7e2
  • Chain 'F':
    Compound: hypothetical protein ychn
    Species: Escherichia coli [TaxId:562]
    Gene:
    Database cross-references and differences (RAF-indexed):
    • Uniprot P0AB52 (0-116)
      • cloning artifact (0)
      • cloning artifact (41)
      • cloning artifact (63)
    Domains in SCOPe 2.06: d1jx7f1, d1jx7f2
  • Heterogens: HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1jx7A (A:)
    mqkivivangapygseslfnslrlaialreqesnldlrlflmsdavtaglrgqkpgegyn
    iqqmleiltaqnvpvklcktctdgrgistlplidgveigtlvelaqwtlsadkvltf
    

  • Chain 'B':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1jx7B (B:)
    mqkivivangapygseslfnslrlaialreqesnldlrlflmsdavtaglrgqkpgegyn
    iqqmleiltaqnvpvklcktctdgrgistlplidgveigtlvelaqwtlsadkvltf
    

  • Chain 'C':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1jx7C (C:)
    mqkivivangapygseslfnslrlaialreqesnldlrlflmsdavtaglrgqkpgegyn
    iqqmleiltaqnvpvklcktctdgrgistlplidgveigtlvelaqwtlsadkvltf
    

  • Chain 'D':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1jx7D (D:)
    mqkivivangapygseslfnslrlaialreqesnldlrlflmsdavtaglrgqkpgegyn
    iqqmleiltaqnvpvklcktctdgrgistlplidgveigtlvelaqwtlsadkvltf
    

  • Chain 'E':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1jx7E (E:)
    mqkivivangapygseslfnslrlaialreqesnldlrlflmsdavtaglrgqkpgegyn
    iqqmleiltaqnvpvklcktctdgrgistlplidgveigtlvelaqwtlsadkvltf
    

  • Chain 'F':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1jx7F (F:)
    mqkivivangapygseslfnslrlaialreqesnldlrlflmsdavtaglrgqkpgegyn
    iqqmleiltaqnvpvklcktctdgrgistlplidgveigtlvelaqwtlsadkvltf