PDB entry 1jx4

View 1jx4 on RCSB PDB site
Description: Crystal Structure of a Y-family DNA Polymerase in a Ternary Complex with DNA Substrates and an Incoming Nucleotide
Class: transferase/DNA
Keywords: DNA polymerase, protein-DNA complex, Y-family, TRANSFERASE-DNA COMPLEX
Deposited on 2001-09-05, released 2001-10-05
The last revision prior to the SCOPe 2.08 freeze date was dated 2011-11-16, with a file datestamp of 2011-11-11.
Experiment type: XRAY
Resolution: 1.7 Å
R-factor: 0.213
AEROSPACI score: 0.52 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: DNA polymerase IV (family Y)
    Species: Sulfolobus solfataricus [TaxId:2287]
    Gene: DPO4
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q97W02 (0-End)
      • modified residue (0)
      • modified residue (75)
      • modified residue (88)
      • modified residue (156)
      • modified residue (215)
      • modified residue (250)
    Domains in SCOPe 2.08: d1jx4a1, d1jx4a2
  • Chain 'P':
    Compound: 5'-d(*gp*gp*gp*gp*gp*ap*ap*gp*gp*ap*cp*tp*a)-3'
  • Chain 'T':
    Compound: 5'-d(*t*tp*cp*ap*tp*tp*ap*gp*tp*cp*cp*tp*tp*cp*cp*cp*cp*c)-3'
  • Heterogens: CA, MG, ADI, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >1jx4A (A:)
    mivlfvdfdyfyaqveevlnpslkgkpvvvcvfsgrfedsgavatanyearkfgvkagip
    iveakkilpnavylpmrkevyqqvssrimnllreysekieiasideayldisdkvrdyre
    aynlgleiknkilekekitvtvgisknkvfakiaadmakpngikviddeevkrlireldi
    advpgignitaeklkklginklvdtlsiefdklkgmigeakakylislardeynepirtr
    vrksigrivtmkrnsrnleeikpylfraieesyykldkripkaihvvavtedldivsrgr
    tfphgisketaysesvkllqkileederkirrigvrfskfieaigldkffdt
    

    Sequence, based on observed residues (ATOM records): (download)
    >1jx4A (A:)
    mivlfvdfdyfyaqveevlnpslkgkpvvvcvfsgrfedsgavatanyearkfgvkagip
    iveakkilpnavylpmrkevyqqvssrimnllreysekieiasideayldisdkvrdyre
    aynlgleiknkilekekitvtvgisknkvfakiaadmakpngikviddeevkrlireldi
    advpgignitaeklkklginklvdtlsiefdklkgmigeakakylislardeynepirtr
    vrksigrivtmkrnsrnleeikpylfraieesyykldkripkaihvvavtedldivsrgr
    tfphgisketaysesvkllqkileederkirrigvrfskfi
    

  • Chain 'P':
    No sequence available.

  • Chain 'T':
    No sequence available.