PDB entry 1jx2

View 1jx2 on RCSB PDB site
Description: crystal structure of the nucleotide-free dynamin a gtpase domain, determined as myosin fusion
Class: hydrolase
Keywords: dynamin, GTPase, myosin, fusion-protein, Dictyostelium, HYDROLASE
Deposited on 2001-09-05, released 2001-11-07
The last revision prior to the SCOPe 2.07 freeze date was dated 2017-10-04, with a file datestamp of 2017-09-29.
Experiment type: XRAY
Resolution: 2.3 Å
R-factor: N/A
AEROSPACI score: 0.24 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Myosin-2 heavy chain,Dynamin-A
    Species: DICTYOSTELIUM DISCOIDEUM [TaxId:44689]
    Gene: dymA, DDB_G0277849
    Database cross-references and differences (RAF-indexed):
    • Uniprot P08799 (13-775)
      • expression tag (12)
      • linker (776-780)
    • Uniprot Q94464 (785-End)
    Domains in SCOPe 2.07: d1jx2a1, d1jx2a2, d1jx2a3, d1jx2a4
  • Heterogens: BGC, MG, ADP, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >1jx2A (A:)
    mhhhhhhhdgtedpihdrtsdyhkylkvkqgdsdlfkltvsdkryiwynpdpkerdsyec
    geivsetsdsftfktvdgqdrqvkkddanqrnpikfdgvedmselsylnepavfhnlrvr
    ynqdliytysglflvavnpfkripiytqemvdifkgrrrnevaphifaisdvayrsmldd
    rqnqsllitgesgagktentkkviqylasvagrnqangsgvleqqilqanpileafgnak
    ttrnnnssrfgkfieiqfnsagfisgasiqsylleksrvvfqseternyhifyqllagat
    aeekkalhlagpesfnylnqsgcvdikgvsdseefkitrqamdivgfsqeeqmsifkiia
    gilhlgnikfekgagegavlkdktalnaastvfgvnpsvlekalmeprilagrdlvaqhl
    nvekssssrdalvkalygrlflwlvkkinnvlcqerkayfigvldisgfeifkvnsfeql
    cinytneklqqffnhhmfkleqeeylkekinwtfidfgldsqatidlidgrqppgilall
    deqsvfpnatdntlitklhshfskknakyeeprfsktefgvthyagqvmyeiqdwleknk
    dplqqdlelcfkdssdnvvtklfndpniasrakkganfitvaaqykeqlaslmatlettn
    phfvrciipnnkqlpakledkvvldqlrcngvlegiritrkgfpnriiyadfvkryylla
    pnvprdaedsqkatdavlkhlnidpeqyrfgitkiffragqlarieeareqriseitrgl
    vprgsdqlipvinklqdvfntlgsdpldlpqivvvgsqssgkssvlenivgrdflprgsg
    ivtrrplilqlthlpiaddgsqtqewgeflhkpndmfydfseireeiirdtdrmtgknkg
    isaqpinlkiysphvvnltlvdlpgitkvpvgdqptdieqqirrmvmayikkqnaiivav
    tpantdlansdalqlakevdpegkrtigvitkldlmdkgtdamevltgrvipltlgfigv
    inrsqediiakksireslkseilyfknhpiyksianrsgtaylsktlnkllmfhirdtlp
    dlkvkvskmlsdvqgelsty
    

    Sequence, based on observed residues (ATOM records): (download)
    >1jx2A (A:)
    dpihdrtsdyhkylkvkqfkltvsdkryiwynpdpkerdsyecgeivsetsdsftfktvd
    gqdrqvkkddanqrnpikfdgvedmselsylnepavfhnlrvrynqdliytysglflvav
    npfkripiytqemvdifkgrrrnevaphifaisdvayrsmlddrqnqsllitgesgagkt
    entkkviqylasvagsgvleqqilqanpileafgnakttrnnnssrfgkfieiqfnsagf
    isgasiqsylleksrvvfqseternyhifyqllagataeekkalhlagpesfnylnqsgc
    vdikgvsdseefkitrqamdivgfsqeeqmsifkiiagilhlgnikfekgagegavlkdk
    talnaastvfgvnpsvlekalmeprilagrdlvaqhlnvekssssrdalvkalygrlflw
    lvkkinnvlcqerkayfigvldisgfeifkvnsfeqlcinytneklqqffnhhmfkleqe
    eylkekinwtfidfgldsqatidlidgrqppgilalldeqsvfpnatdntlitklhshfs
    kknakyeeprfsktefgvthyagqvmyeiqdwleknkdplqqdlelcfkdssdnvvtklf
    ndpniasrakkganfitvaaqykeqlaslmatlettnphfvrciipnnkqlpakledkvv
    ldqlrcngvlegiritrkgfpnriiyadfvkryyllapnvprdaedsqkatdavlkhlni
    dpeqyrfgitkiffragqlarieeareqriseitrglvdqlipvinklqdvfntlgsdpl
    dlpqivvvgsqssgkssvlenivgrdflprplilqlthlpiaddgsqtqewgeflhkpnd
    mfydfseireeiirdtdisaqpinlkiysphvvnltlvdlpgitdieqqirrmvmayikk
    qnaiivavtpantdlansdalqlakevdpegkrtigvitkldlmdkgtdamevltgrvip
    ltlgfigvinrsqediiakksireslkseilyfknhpiyksianrsgtaylsktlnkllm
    fhirdtlpdlkvkvskmls