PDB entry 1jx1

View 1jx1 on RCSB PDB site
Description: Chalcone Isomerase--T48A mutant
Class: isomerase
Keywords: open-faced beta sandwich, unique fold, ISOMERASE
Deposited on 2001-09-05, released 2002-07-24
The last revision prior to the SCOPe 2.07 freeze date was dated 2009-02-24, with a file datestamp of 2009-03-01.
Experiment type: XRAY
Resolution: 2.3 Å
R-factor: 0.23
AEROSPACI score: 0.32 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: chalcone--flavonone isomerase 1
    Species: Medicago sativa [TaxId:3879]
    Database cross-references and differences (RAF-indexed):
    • Uniprot P28012 (Start-221)
      • engineered (47)
    Domains in SCOPe 2.07: d1jx1a_
  • Chain 'B':
    Compound: chalcone--flavonone isomerase 1
    Species: Medicago sativa [TaxId:3879]
    Database cross-references and differences (RAF-indexed):
    • Uniprot P28012
      • engineered (47)
    Domains in SCOPe 2.07: d1jx1b_
  • Chain 'C':
    Compound: chalcone--flavonone isomerase 1
    Species: Medicago sativa [TaxId:3879]
    Database cross-references and differences (RAF-indexed):
    • Uniprot P28012
      • engineered (47)
    Domains in SCOPe 2.07: d1jx1c_
  • Chain 'D':
    Compound: chalcone--flavonone isomerase 1
    Species: Medicago sativa [TaxId:3879]
    Database cross-references and differences (RAF-indexed):
    • Uniprot P28012 (Start-221)
      • engineered (47)
    Domains in SCOPe 2.07: d1jx1d_
  • Chain 'E':
    Compound: chalcone--flavonone isomerase 1
    Species: Medicago sativa [TaxId:3879]
    Database cross-references and differences (RAF-indexed):
    • Uniprot P28012
      • engineered (47)
    Domains in SCOPe 2.07: d1jx1e_
  • Chain 'F':
    Compound: chalcone--flavonone isomerase 1
    Species: Medicago sativa [TaxId:3879]
    Database cross-references and differences (RAF-indexed):
    • Uniprot P28012
      • engineered (47)
    Domains in SCOPe 2.07: d1jx1f_
  • Heterogens: SO4, DFV, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >1jx1A (A:)
    maasitaitvenleypavvtspvtgksyflggagergltiegnfikfaaigvylediava
    slaakwkgksseelletldfyrdiisgpfeklirgskirelsgpeysrkvmencvahlks
    vgtygdaeaeamqkfaeafkpvnfppgasvfyrqspdgilglsfspdtsipekeaalien
    kavssavletmigehavspdlkrclaarlpallnegafkign
    

    Sequence, based on observed residues (ATOM records): (download)
    >1jx1A (A:)
    asitaitvenleypavvtspvtgksyflggagergltinfikfaaigvylediavaslaa
    kwkgksseelletldfyrdiisgpfeklirgskirelsgpeysrkvmencvahlksvgty
    gdaeaeamqkfaeafkpvnfppgasvfyrqspdgilglsfspdtsipekeaalienkavs
    savletmigehavspdlkrclaarlpallnegafkign
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >1jx1B (B:)
    maasitaitvenleypavvtspvtgksyflggagergltiegnfikfaaigvylediava
    slaakwkgksseelletldfyrdiisgpfeklirgskirelsgpeysrkvmencvahlks
    vgtygdaeaeamqkfaeafkpvnfppgasvfyrqspdgilglsfspdtsipekeaalien
    kavssavletmigehavspdlkrclaarlpallnegafkign
    

    Sequence, based on observed residues (ATOM records): (download)
    >1jx1B (B:)
    sitaitvenleypavvtspvtgksyflggagergltiegnfikfaaigvylediavasla
    akwkgksseelletldfyrdiisgpfeklirgskirelsgpeysrkvmencvahlksvgt
    ygdaeaeamqkfaeafkpvnfppgasvfyrqspdgilglsfspdtsipekeaalienkav
    ssavletmigehavspdlkrclaarlpallnegafki
    

  • Chain 'C':
    Sequence, based on SEQRES records: (download)
    >1jx1C (C:)
    maasitaitvenleypavvtspvtgksyflggagergltiegnfikfaaigvylediava
    slaakwkgksseelletldfyrdiisgpfeklirgskirelsgpeysrkvmencvahlks
    vgtygdaeaeamqkfaeafkpvnfppgasvfyrqspdgilglsfspdtsipekeaalien
    kavssavletmigehavspdlkrclaarlpallnegafkign
    

    Sequence, based on observed residues (ATOM records): (download)
    >1jx1C (C:)
    sitaitvenleypavvtspvtgksyflggagergltiegnfikfaaigvylediavasla
    akwkgksseelletldfyrdiisgpfeklirgskirelsgpeysrkvmencvahlksvgt
    ygdaeaeamqkfaeafkpvnfppgasvfyrqspdgilglsfspdtsipekeaalienkav
    ssavletmigehavspdlkrclaarlpallne
    

  • Chain 'D':
    Sequence, based on SEQRES records: (download)
    >1jx1D (D:)
    maasitaitvenleypavvtspvtgksyflggagergltiegnfikfaaigvylediava
    slaakwkgksseelletldfyrdiisgpfeklirgskirelsgpeysrkvmencvahlks
    vgtygdaeaeamqkfaeafkpvnfppgasvfyrqspdgilglsfspdtsipekeaalien
    kavssavletmigehavspdlkrclaarlpallnegafkign
    

    Sequence, based on observed residues (ATOM records): (download)
    >1jx1D (D:)
    aasitaitvenleypavvtspvtgksyflggagergltkfaaigvylediavaslaakwk
    gksseelletldfyrdiisgpfeklirgskirelsgpeysrkvmencvahlksvgtygda
    eaeamqkfaeafkpvnfppgasvfyrqspdgilglsfspdtsipekeaalienkavssav
    letmigehavspdlkrclaarlpallnegafkign
    

  • Chain 'E':
    Sequence, based on SEQRES records: (download)
    >1jx1E (E:)
    maasitaitvenleypavvtspvtgksyflggagergltiegnfikfaaigvylediava
    slaakwkgksseelletldfyrdiisgpfeklirgskirelsgpeysrkvmencvahlks
    vgtygdaeaeamqkfaeafkpvnfppgasvfyrqspdgilglsfspdtsipekeaalien
    kavssavletmigehavspdlkrclaarlpallnegafkign
    

    Sequence, based on observed residues (ATOM records): (download)
    >1jx1E (E:)
    asitaitvenleypavvtspvtgksyflggagerglfikfaaigvylediavaslaakwk
    gksseelletldfyrdiisgpfeklirgskirelsgpeysrkvmencvahlksvgtygda
    eaeamqkfaeafkpvnfppgasvfyrqspdgilglsfspdtsipekeaalienkavssav
    letmigehavspdlkrclaarlpallnegafki
    

  • Chain 'F':
    Sequence, based on SEQRES records: (download)
    >1jx1F (F:)
    maasitaitvenleypavvtspvtgksyflggagergltiegnfikfaaigvylediava
    slaakwkgksseelletldfyrdiisgpfeklirgskirelsgpeysrkvmencvahlks
    vgtygdaeaeamqkfaeafkpvnfppgasvfyrqspdgilglsfspdtsipekeaalien
    kavssavletmigehavspdlkrclaarlpallnegafkign
    

    Sequence, based on observed residues (ATOM records): (download)
    >1jx1F (F:)
    itaitvenleypavvtspvtgksyflggagerglfikfaaigvylediavaslaakwkgk
    sseelletldfyrdiisgpfeklirgskirelsgpeysrkvmencvahlksvgtygdaea
    eamqkfaeafkpvnfppgasvfyrqspdgilglsfspdtsipekeaalienkavssavle
    tmigehavspdlkrclaarlpallne