PDB entry 1jwz

View 1jwz on RCSB PDB site
Description: Crystal structure of TEM-64 beta-lactamase in complex with a boronic acid inhibitor (105)
Class: hydrolase
Keywords: tem-64, beta-lactamase, serine hydrolase, crystal structure, evolution, antibiotic resistance
Deposited on 2001-09-05, released 2002-06-05
The last revision prior to the SCOPe 2.05 freeze date was dated 2009-02-24, with a file datestamp of 2009-03-01.
Experiment type: XRAY
Resolution: 1.8 Å
R-factor: 0.168
AEROSPACI score: 0.55 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Beta-lactamase TEM
    Species: Escherichia coli [TaxId:562]
    Gene: bla
    Database cross-references and differences (RAF-indexed):
    • Uniprot P62593 (0-262)
      • engineered (78)
      • engineered (138)
      • engineered (156)
    Domains in SCOPe 2.05: d1jwza_
  • Heterogens: 105, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1jwzA (A:)
    hpetlvkvkdaedqlgarvgyieldlnsgkilesfrpeerfpmmstfkvllcgavlsrvd
    agqeqlgrrihysqndlvkyspvtekhltdgmtvrelcsaaitmsdntaanlllttiggp
    keltaflhnmgdhvtrldswepelneaipnderdtttpaamattlrklltgelltlasrq
    qlidwmeadkvagpllrsalpagwfiadksgagergsrgiiaalgpdgkpsrivviyttg
    sqatmdernrqiaeigaslikhw