PDB entry 1jwy

View 1jwy on RCSB PDB site
Description: crystal structure of the dynamin a gtpase domain complexed with GDP, determined as myosin fusion
Class: hydrolase
Keywords: dynamin, GTPase, GDP, myosin, fusion-protein, Dictyostelium
Deposited on 2001-09-05, released 2001-11-07
The last revision prior to the SCOP 1.75 freeze date was dated 2003-04-01, with a file datestamp of 2007-06-04.
Experiment type: XRAY
Resolution: 2.3 Å
R-factor: 0.203
AEROSPACI score: 0.44 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: myosin II heavy chain
    Species: Dictyostelium discoideum
    Database cross-references and differences (RAF-indexed):
    • Uniprot P08799 (13-775)
      • his tag (12)
      • see remark 999 (259)
      • see remark 999 (322)
    Domains in SCOP 1.75: d1jwya1, d1jwya2
  • Chain 'B':
    Compound: Dynamin A GTPase domain
    Species: Dictyostelium discoideum
    Gene: dymA
    Database cross-references and differences (RAF-indexed): Domains in SCOP 1.75: d1jwyb_
  • Chain 'C':
    Compound: Linker Peptide
    Species: Dictyostelium discoideum
  • Heterogens: GLC, MG, ADP, GDP, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >1jwyA (A:)
    mhhhhhhhdgtedpihdrtsdyhkylkvkqgdsdlfkltvsdkryiwynpdpkerdsyec
    geivsetsdsftfktvdgqdrqvkkddanqrnpikfdgvedmselsylnepavfhnlrvr
    ynqdliytysglflvavnpfkripiytqemvdifkgrrrnevaphifaisdvayrsmldd
    rqnqsllitgesgagktentkkviqylasvagrnqangsgvleqqilqanpileafgnak
    ttrnnnssrfgkfieiqfnsagfisgasiqsylleksrvvfqseternyhifyqllagat
    aeekkalhlagpesfnylnqsgcvdikgvsdseefkitrqamdivgfsqeeqmsifkiia
    gilhlgnikfekgagegavlkdktalnaastvfgvnpsvlekalmeprilagrdlvaqhl
    nvekssssrdalvkalygrlflwlvkkinnvlcqerkayfigvldisgfeifkvnsfeql
    cinytneklqqffnhhmfkleqeeylkekinwtfidfgldsqatidlidgrqppgilall
    deqsvfpnatdntlitklhshfskknakyeeprfsktefgvthyagqvmyeiqdwleknk
    dplqqdlelcfkdssdnvvtklfndpniasrakkganfitvaaqykeqlaslmatlettn
    phfvrciipnnkqlpakledkvvldqlrcngvlegiritrkgfpnriiyadfvkryylla
    pnvprdaedsqkatdavlkhlnidpeqyrfgitkiffragqlarieeareqrisei
    

    Sequence, based on observed residues (ATOM records): (download)
    >1jwyA (A:)
    dpihdrtsdyhkylkvkqfkltvsdkryiwynpdpkerdsyecgeivsetsdsftfktvd
    gqdrqvkkddanqrnpikfdgvedmselsylnepavfhnlrvrynqdliytysglflvav
    npfkripiytqemvdifkgrrrnevaphifaisdvayrsmlddrqnqsllitgesgagkt
    entkkviqylasvagsgvleqqilqanpileafgnakttrnnnssrfgkfieiqfnsagf
    isgasiqsylleksrvvfqseternyhifyqllagataeekkalhlagpesfnylnqsgc
    vdikgvsdseefkitrqamdivgfsqeeqmsifkiiagilhlgnikfekgagegavlkdk
    talnaastvfgvnpsvlekalmeprilagrdlvaqhlnvekssssrdalvkalygrlflw
    lvkkinnvlcqerkayfigvldisgfeifkvnsfeqlcinytneklqqffnhhmfkleqe
    eylkekinwtfidfgldsqatidlidgrqppgilalldeqsvfpnatdntlitklhshfs
    kknakyeeprfsktefgvthyagqvmyeiqdwleknkdplqqdlelcfkdssdnvvtklf
    ndpniasrakkganfitvaaqykeqlaslmatlettnphfvrciipnnkqlpakledkvv
    ldqlrcngvlegiritrkgfpnriiyadfvkryyllapnvprdaedsqkatdavlkhlni
    dpeqyrfgitkiffragqlarieeareqrisei
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >1jwyB (B:)
    dqlipvinklqdvfntlgsdpldlpqivvvgsqssgkssvlenivgrdflprgsgivtrr
    plilqlthlpiaddgsqtqewgeflhkpndmfydfseireeiirdtdrmtgknkgisaqp
    inlkiysphvvnltlvdlpgitkvpvgdqptdieqqirrmvmayikkqnaiivavtpant
    dlansdalqlakevdpegkrtigvitkldlmdkgtdamevltgrvipltlgfigvinrsq
    ediiakksireslkseilyfknhpiyksianrsgtaylsktlnkllmfhirdtlpdlkvk
    vskmlsdvqgelsty
    

    Sequence, based on observed residues (ATOM records): (download)
    >1jwyB (B:)
    dqlipvinklqdvfntlgsdpldlpqivvvgsqssgkssvlenivgrdflprplilqlth
    lpiaddgsqtqewgeflhkpndmfydfseireeiirdtdisaqpinlkiysphvvnltlv
    dlpgitdieqqirrmvmayikkqnaiivavtpantdlansdalqlakevdpegkrtigvi
    tkldlmdkgtdamevltgrvipltlgfigvinrsqediiakksireslkseilyfknhpi
    yksianrsgtaylsktlnkllmfhirdtlpdlkvkvskmls
    

  • Chain 'C':
    No sequence available.