PDB entry 1jww

View 1jww on RCSB PDB site
Description: NMR characterization of the N-terminal domain of a potential copper-translocating P-type ATPase from Bacillus subtilis
Class: hydrolase
Keywords: beta-alpha-beta-beta-alpha-beta, HYDROLASE
Deposited on 2001-09-05, released 2002-04-10
The last revision prior to the SCOPe 2.08 freeze date was dated 2009-02-24, with a file datestamp of 2009-02-03.
Experiment type: NMR
Resolution: N/A
R-factor: N/A
AEROSPACI score: 0.02 (click here for full SPACI score report)

Chains and heterogens:

• Chain 'A':
  Compound: Potential copper-transporting ATPase
  Species: Bacillus subtilis [TaxId:1423]
  Gene: yvgX
  Database cross-references and differences (RAF-indexed):
  • Uniprot O32220 (0-79)
    • see remark 999 (76)
    • see remark 999 (78-79)
    • see remark 999 (77)
  Domains in SCOPe 2.08: d1jwwa_

PDB Chain Sequences:

• Chain 'A':
  Sequence; same for both SEQRES and ATOM records: (download)
  

  >1jwwA (A:)
  vtekaefdiegmtcaacanriekrlnkiegvanapvnfaletvtveynpkeasvsdlkea
  vdklgyklklkgeqdsiegr