PDB entry 1jwt

View 1jwt on RCSB PDB site
Description: crystal structure of thrombin in complex with a novel bicyclic lactam inhibitor
Class: hydrolase
Keywords: hydrolase
Deposited on 2001-09-05, released 2002-02-27
The last revision prior to the SCOPe 2.07 freeze date was dated 2017-10-04, with a file datestamp of 2017-09-29.
Experiment type: XRAY
Resolution: 2.5 Å
R-factor: N/A
AEROSPACI score: 0.19 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Prothrombin
    Species: Homo sapiens [TaxId:9606]
    Database cross-references and differences (RAF-indexed):
    • Uniprot P00734 (0-294)
      • cloning artifact (295-304)
    Domains in SCOPe 2.07: d1jwta1, d1jwta2
  • Heterogens: BLI

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >1jwtA (A:)
    tfgsgeadcglrplfekksledkterellesyidgrivegsdaeigmspwqvmlfrkspq
    ellcgaslisdrwvltaahcllyppwdknftendllvrigkhsrtryerniekismleki
    yihprynwrenldrdialmklkkpvafsdyihpvclpdretaasllqagykgrvtgwgnl
    ketwtanvgkgqpsvlqvvnlpiverpvckdstriritdnmfcagykpdegkrgdacegd
    sggpfvmkspfnnrwyqmgivswgegcdrdgkygfythvfrlkkwiqkvidqfgedfeei
    peeyl
    

    Sequence, based on observed residues (ATOM records): (download)
    >1jwtA (A:)
    tfgsgeadcglrplfekksledkterellesyidgrivegsdaeigmspwqvmlfrkspq
    ellcgaslisdrwvltaahcllyppwdknftendllvrigkhsrtryerniekismleki
    yihprynwrenldrdialmklkkpvafsdyihpvclpdretaasllqagykgrvtgwgnl
    ketwgqpsvlqvvnlpiverpvckdstriritdnmfcagykpdegkrgdacegdsggpfv
    mkspfnnrwyqmgivswgegcdrdgkygfythvfrlkkwiqkvidqfgedfeeipeeyl