PDB entry 1jwq

View 1jwq on RCSB PDB site
Description: structure of the catalytic domain of cwlv, n-acetylmuramoyl-l-alanine amidase from bacillus(paenibacillus) polymyxa var.colistinus
Deposited on 2001-09-05, released 2003-11-18
The last revision prior to the SCOP 1.67 freeze date was dated 2003-11-18, with a file datestamp of 2003-11-18.
Experiment type: XRAY
Resolution: 1.8 Å
R-factor: 0.176
AEROSPACI score: 0.52 (click here for full SPACI score report)

Chains and heterogens:

• Chain 'A':
  Domains in SCOP 1.67: d1jwqa_

PDB Chain Sequences:

• Chain 'A':
  Sequence; same for both SEQRES and ATOM records: (download)
  

  >1jwqA (A:)
  mkvvvidaghgakdsgavgisrknyektfnlamalkvesilkqnpklevvltrsddtfle
  lkqrvkvaenlkanvfvsihanssgssasngtetyyqrsaskafanvmhkyfapatgltd
  rgirygnfhvirettmpavllevgylsnakeeatlfdedfqnrvaqgiadgiteyldvk