PDB entry 1jwq

View 1jwq on RCSB PDB site
Description: Structure of the catalytic domain of CwlV, N-acetylmuramoyl-L-alanine amidase from Bacillus(Paenibacillus) polymyxa var.colistinus
Class: hydrolase
Keywords: open alpha-beta-alpha, HYDROLASE
Deposited on 2001-09-05, released 2003-11-18
The last revision prior to the SCOPe 2.08 freeze date was dated 2009-02-24, with a file datestamp of 2009-03-01.
Experiment type: XRAY
Resolution: 1.8 Å
R-factor: 0.176
AEROSPACI score: 0.52 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: N-ACETYLMURAMOYL-L-ALANINE AMIDASE CwlV
    Species: Paenibacillus polymyxa [TaxId:1406]
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q9LCR3 (1-178)
      • initiating met (0)
    Domains in SCOPe 2.08: d1jwqa_
  • Heterogens: ZN, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1jwqA (A:)
    mkvvvidaghgakdsgavgisrknyektfnlamalkvesilkqnpklevvltrsddtfle
    lkqrvkvaenlkanvfvsihanssgssasngtetyyqrsaskafanvmhkyfapatgltd
    rgirygnfhvirettmpavllevgylsnakeeatlfdedfqnrvaqgiadgiteyldvk