PDB entry 1jwo

View 1jwo on RCSB PDB site
Description: Crystal Structure Analysis of the SH2 Domain of the Csk Homologous Kinase CHK
Class: transferase
Keywords: antiparallel beta sheet, transferase
Deposited on 2001-09-04, released 2001-09-12
The last revision prior to the SCOPe 2.08 freeze date was dated 2009-02-24, with a file datestamp of 2009-02-03.
Experiment type: XRAY
Resolution: 2.5 Å
R-factor: 0.194
AEROSPACI score: 0.24 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Csk Homologous Kinase
    Species: Homo sapiens [TaxId:9606]
    Gene: MATK
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.08: d1jwoa_
  • Heterogens: HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download) 
    >1jwoA (A:)
lslmpwfhgkisgqeavqqlqppedglflvresarhpgdyvlcvsfgrdvihyrvlhrdg
hltideavffcnlmdmvehyskdkgaictklvrpkrk