PDB entry 1jwl

View 1jwl on RCSB PDB site
Description: structure of the dimeric lac repressor/operator o1/onpf complex
Deposited on 2001-09-04, released 2001-10-05
The last revision prior to the SCOP 1.61 freeze date was dated 2001-10-05, with a file datestamp of 2001-10-05.
Experiment type: XRAY
Resolution: 4 Å
R-factor: 0.249
AEROSPACI score: 0.12 (click here for full SPACI score report)

Chains and heterogens:

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1jwlA (A:)
    kpvtlydvaeyagvsyqtvsrvvnqashvsaktrekveaamaelnyipnrvaqqlagkqs
    lligvatsslalhapsqivaaiksradqlgasvvvsmversgveacktavhnllaqrvsg
    liinyplddqdaiaveaactnvpalfldvsdqtpinsiifshedgtrlgvehlvalghqq
    iallagplssvsarlrlagwhkyltrnqiqpiaeregdwsamsgfqqtmqmlnegivpta
    mlvandqmalgamraitesglrvgadisvvgyddtedsscyipplttikqdfrllgqtsv
    drllqlsqgqavkgnqllpvslvkrkttl
    

  • Chain 'B':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1jwlB (B:)
    kpvtlydvaeyagvsyqtvsrvvnqashvsaktrekveaamaelnyipnrvaqqlagkqs
    lligvatsslalhapsqivaaiksradqlgasvvvsmversgveacktavhnllaqrvsg
    liinyplddqdaiaveaactnvpalfldvsdqtpinsiifshedgtrlgvehlvalghqq
    iallagplssvsarlrlagwhkyltrnqiqpiaeregdwsamsgfqqtmqmlnegivpta
    mlvandqmalgamraitesglrvgadisvvgyddtedsscyipplttikqdfrllgqtsv
    drllqlsqgqavkgnqllpvslvkrkttl
    

  • Chain 'C':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1jwlC (C:)
    lligvatsslalhapsqivaaiksradqlgasvvvsmversgveacktavhnllaqrvsg
    liinyplddqdaiaveaactnvpalfldvsdqtpinsiifshedgtrlgvehlvalghqq
    iallagplssvsarlrlagwhkyltrnqiqpiaeregdwsamsgfqqtmqmlnegivpta
    mlvandqmalgamraitesglrvgadisvvgyddtedsscyipplttikqdfrllgqtsv
    drllqlsqgqavkgnqllpvslvkrkttl