PDB entry 1jwj

View 1jwj on RCSB PDB site
Description: Murine Inducible Nitric Oxide Synthase Oxygenase Dimer (Delta 65) with W457F Mutation at Tetrahydrobiopterin Binding Site
Class: oxidoreductase
Keywords: Nitric Oxide L-Arginine Monooxygenase, Heme, Dimer, NOS, OXIDOREDUCTASE
Deposited on 2001-09-04, released 2001-10-31
The last revision prior to the SCOPe 2.08 freeze date was dated 2020-07-29, with a file datestamp of 2020-07-04.
Experiment type: XRAY
Resolution: 2.6 Å
R-factor: N/A
AEROSPACI score: 0.28 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: nitric oxide synthase
    Species: Mus musculus [TaxId:10090]
    Database cross-references and differences (RAF-indexed):
    • Uniprot P29477
      • engineered (391)
    Domains in SCOPe 2.08: d1jwja_
  • Chain 'B':
    Compound: nitric oxide synthase
    Species: Mus musculus [TaxId:10090]
    Database cross-references and differences (RAF-indexed):
    • Uniprot P29477
      • engineered (391)
    Domains in SCOPe 2.08: d1jwjb_
  • Heterogens: BOG, HEM, H4B, GOL, EDO, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >1jwjA (A:)
    ldklhvtstrpqyvriknwgsgeilhdtlhhkatsdftcksksclgsimnpksltrgprd
    kptpleellphaiefinqyygsfkeakieehlarleavtkeiettgtyqltldelifatk
    mawrnaprcigriqwsnlqvfdarncstaqemfqhicrhilyatnngnirsaitvfpqrs
    dgkhdfrlwnsqliryagyqmpdgtirgdaatleftqlcidlgwkprygrfdvlplvlqa
    dgqdpevfeippdlvlevtmehpkyewfqelglkwyalpavanmllevgglefpacpfng
    wymgteigvrdfcdtqrynileevgrrmglethtlaslwkdravteinvavlhsfqkqnv
    timdhhtasesfmkhmqneyrarggcpadwiflvppvsgsitpvfhqemlnyvlspfyyy
    qiepwkthiwqne
    

    Sequence, based on observed residues (ATOM records): (download)
    >1jwjA (A:)
    qyvriknwgsgeilhdtlhhkatclgsimnpksltrgprdkptpleellphaiefinqyy
    gsfkeakieehlarleavtkeiettgtyqltldelifatkmawrnaprcigriqwsnlqv
    fdarncstaqemfqhicrhilyatnngnirsaitvfpqrsdgkhdfrlwnsqliryagyq
    mpdgtirgdaatleftqlcidlgwkprygrfdvlplvlqadgqdpevfeippdlvlevtm
    ehpkyewfqelglkwyalpavanmllevgglefpacpfngwymgteigvrdfcdtqryni
    leevgrrmglethtlaslwkdravteinvavlhsfqkqnvtimdhhtasesfmkhmqney
    rarggcpadwiflvppvsgsitpvfhqemlnyvlspfyyyqiepwkthiwqn
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >1jwjB (B:)
    ldklhvtstrpqyvriknwgsgeilhdtlhhkatsdftcksksclgsimnpksltrgprd
    kptpleellphaiefinqyygsfkeakieehlarleavtkeiettgtyqltldelifatk
    mawrnaprcigriqwsnlqvfdarncstaqemfqhicrhilyatnngnirsaitvfpqrs
    dgkhdfrlwnsqliryagyqmpdgtirgdaatleftqlcidlgwkprygrfdvlplvlqa
    dgqdpevfeippdlvlevtmehpkyewfqelglkwyalpavanmllevgglefpacpfng
    wymgteigvrdfcdtqrynileevgrrmglethtlaslwkdravteinvavlhsfqkqnv
    timdhhtasesfmkhmqneyrarggcpadwiflvppvsgsitpvfhqemlnyvlspfyyy
    qiepwkthiwqne
    

    Sequence, based on observed residues (ATOM records): (download)
    >1jwjB (B:)
    qyvriknwgsgeilhdtlhhkatlgsimnpksltrgprdkptpleellphaiefinqyyg
    sfkeakieehlarleavtkeiettgtyqltldelifatkmawrnaprcigriqwsnlqvf
    darncstaqemfqhicrhilyatnngnirsaitvfpqrsdgkhdfrlwnsqliryagyqm
    pdgtirgdaatleftqlcidlgwkprygrfdvlplvlqadgqdpevfeippdlvlevtme
    hpkyewfqelglkwyalpavanmllevgglefpacpfngwymgteigvrdfcdtqrynil
    eevgrrmglethtlaslwkdravteinvavlhsfqkqnvtimdhhtasesfmkhmqneyr
    arggcpadwiflvppvsgsitpvfhqemlnyvlspfyyyqiepwkthiwqn