PDB entry 1jwi

View 1jwi on RCSB PDB site
Description: Crystal Structure of Bitiscetin, a von Willeband Factor-dependent Platelet Aggregation Inducer.
Class: toxin
Keywords: Domain swapping, C-type lectin, TOXIN
Deposited on 2001-09-04, released 2001-11-28
The last revision prior to the SCOPe 2.06 freeze date was dated 2009-02-24, with a file datestamp of 2009-02-03.
Experiment type: XRAY
Resolution: 2 Å
R-factor: 0.207
AEROSPACI score: 0.42 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: bitiscetin
    Species: Bitis arietans [TaxId:8692]
    Database cross-references and differences (RAF-indexed):
    • GB JC5058
    Domains in SCOPe 2.06: d1jwia_
  • Chain 'B':
    Compound: platelet aggregation inducer
    Species: Bitis arietans [TaxId:8692]
    Database cross-references and differences (RAF-indexed):
    • GB JC5059 (Start-124)
    Domains in SCOPe 2.06: d1jwib_
  • Heterogens: HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >1jwiA (A:)
    dpgclpdwssykghcykvfkkvgtwedaekfcvensghlasidskeeadfvtklasqtlt
    kfvydawiglrdesktqqcspqwtdgssvvyenvdeptkcfgldvhteyrtwtdlpcgek
    npficksrlph
    

    Sequence, based on observed residues (ATOM records): (download)
    >1jwiA (A:)
    clpdwssykghcykvfkkvgtwedaekfcvensghlasidskeeadfvtklasqtlfvyd
    awiglrdesktqqcspqwtdgssvvyenvdeptkcfgldvhteyrtwtdlpcgeknpfic
    ks
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >1jwiB (B:)
    degclpdwssykghcykvfkvektwadaekfckelvngghlmsvnsreegefisklalek
    mrivlvwiglshfwricplrwtdgarldyralsdepicfvaesfhnkwiqwtcnrkksfv
    ckyrv
    

    Sequence, based on observed residues (ATOM records): (download)
    >1jwiB (B:)
    gclpdwssykghcykvfkvektwadaekfckelvngghlmsvnsreegefisklalekmr
    ivlvwiglshfwricplrwtdgarldyralsdepicfvaesfhnkwiqwtcnrkksfvck
    yrv