PDB entry 1jwi

View 1jwi on RCSB PDB site
Description: Crystal Structure of Bitiscetin, a von Willeband Factor-dependent Platelet Aggregation Inducer.
Deposited on 2001-09-04, released 2001-11-28
The last revision prior to the SCOP 1.59 freeze date was dated 2001-11-28, with a file datestamp of 2001-11-28.
Experiment type: XRAY
Resolution: 2 Å
R-factor: 0.207
AEROSPACI score: 0.42 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Domains in SCOP 1.59: d1jwia_
  • Chain 'B':
    Domains in SCOP 1.59: d1jwib_

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >1jwiA (A:)
    clpdwssykghcykvfkkvgtwedaekfcvensghlasidskeeadfvtklasqtltkfv
    ydawiglrdesktqqcspqwtdgssvvyenvdeptkcfgldvhteyrtwtdlpcgeknpf
    icks
    

    Sequence, based on observed residues (ATOM records): (download)
    >1jwiA (A:)
    clpdwssykghcykvfkkvgtwedaekfcvensghlasidskeeadfvtklasqtlfvyd
    awiglrdesktqqcspqwtdgssvvyenvdeptkcfgldvhteyrtwtdlpcgeknpfic
    ks
    

  • Chain 'B':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1jwiB (B:)
    gclpdwssykghcykvfkvektwadaekfckelvngghlmsvnsreegefisklalekmr
    ivlvwiglshfwricplrwtdgarldyralsdepicfvaesfhnkwiqwtcnrkksfvck
    yrv