PDB entry 1jw9

View 1jw9 on RCSB PDB site
Description: Structure of the Native MoeB-MoaD Protein Complex
Class: ligase
Keywords: MoeB: modified Rossmann fold; (2) Cys-X-X-Cys Zinc-binding motifs; MoaD: ubiquitin-like fold, LIGASE
Deposited on 2001-09-03, released 2001-11-21
The last revision prior to the SCOPe 2.07 freeze date was dated 2011-07-13, with a file datestamp of 2011-05-08.
Experiment type: XRAY
Resolution: 1.7 Å
R-factor: 0.176
AEROSPACI score: 0.56 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'B':
    Compound: molybdopterin biosynthesis moeb protein
    Species: Escherichia coli [TaxId:562]
    Gene: MoeB
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d1jw9b_
  • Chain 'D':
    Compound: molybdopterin [mpt] converting factor, subunit 1
    Species: Escherichia coli [TaxId:562]
    Gene: MoaD
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d1jw9d_
  • Heterogens: ZN, SO4, HOH

PDB Chain Sequences:

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >1jw9B (B:)
    maelsdqemlrynrqiilrgfdfdgqealkdsrvlivglgglgcaasqylasagvgnltl
    ldfdtvslsnlqrqtlhsdatvgqpkvesardaltrinphiaitpvnallddaelaalia
    ehdlvldctdnvavrnqlnagcfaakvplvsgaairmegqitvftyqdgepcyrclsrlf
    genaltcveagvmapligvigslqameaikmlagygkpasgkivmydamtcqfremklmr
    npgcevcgq
    

    Sequence, based on observed residues (ATOM records): (download)
    >1jw9B (B:)
    aelsdqemlrynrqiilrgfdfdgqealkdsrvlivglgglgcaasqylasagvgnltll
    dfdtvslsnlqrqtlhsdatvgqpkvesardaltrinphiaitpvnallddaelaaliae
    hdlvldctdnvavrnqlnagcfaakvplvsgaairmegqitvftyqdgepcyrclsrlfg
    eagvmapligvigslqameaikmlagygkpasgkivmydamtcqfremklmrnpgcevcg
    

  • Chain 'D':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1jw9D (D:)
    mikvlffaqvrelvgtdatevaadfptvealrqhmaaqsdrwalaledgkllaavnqtlv
    sfdhpltdgdevaffppvtgg