PDB entry 1jw8

View 1jw8 on RCSB PDB site
Description: 1.3 angstrom resolution crystal structure of p6 form of myoglobin
Class: oxygen storage/transport
Keywords: anisotropic refinement myoglobin, OXYGEN STORAGE-TRANSPORT COMPLEX
Deposited on 2001-09-03, released 2001-10-10
The last revision prior to the SCOPe 2.06 freeze date was dated 2013-01-30, with a file datestamp of 2013-01-25.
Experiment type: XRAY
Resolution: 1.3 Å
R-factor: 0.135
AEROSPACI score: 0.81 (click here for full SPACI score report)

Chains and heterogens:

• Chain 'A':
  Compound: Myoglobin
  Species: Physeter catodon [TaxId:9755]
  Gene: MB (Synthesized)
  Database cross-references and differences (RAF-indexed):
  • Uniprot P02185 (1-153)
    • see remark 999 (0)
    • see remark 999 (122)
  Domains in SCOPe 2.06: d1jw8a_
• Heterogens: SO4, HEM, CMO, HOH

PDB Chain Sequences:

• Chain 'A':
  Sequence; same for both SEQRES and ATOM records: (download)
  

  >1jw8A (A:)
  mvlsegewqlvlhvwakveadvaghgqdilirlfkshpetlekfdrfkhlkteaemkase
  dlkkhgvtvltalgailkkkghheaelkplaqshatkhkipikylefiseaiihvlhsrh
  pgnfgadaqgamnkalelfrkdiaakykelgyqg