PDB entry 1jw7

View 1jw7 on RCSB PDB site
Description: Crystal structure of Enoyl-Acyl Carrier protein Reductase from Helicobacter pylori
Deposited on 2001-09-03, released 2003-11-11
The last revision prior to the SCOP 1.67 freeze date was dated 2003-11-11, with a file datestamp of 2003-11-11.
Experiment type: XRAY
Resolution: 2.3 Å
R-factor: 0.238
AEROSPACI score: 0.2 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Domains in SCOP 1.67: d1jw7a_
  • Chain 'B':
    Domains in SCOP 1.67: d1jw7b_
  • Chain 'C':
    Domains in SCOP 1.67: d1jw7c_
  • Chain 'D':
    Domains in SCOP 1.67: d1jw7d_

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >1jw7A (A:)
    mgflkgkkglivgvannksiaygiaqscfnqgatlaftylneslekrvrpiaqelnspyv
    yeldvskeehfkslynsvkkdlgsldfivhsvafapkealegslletsksafntameisv
    yslieltntlkpllnngasvltlsylgstkymahynvmglakaalesavrylavdlgkhh
    irvnalsagpirtlassgiadfrmilkwneinaplrknvsleevgnagmyllsslssgvs
    gevhfvdagyhvmgmgaveekdnkatllwdlhkeq
    

    Sequence, based on observed residues (ATOM records): (download)
    >1jw7A (A:)
    gflkgkkglivgvannksiaygiaqscfnqgatlaftylneslekrvrpiaqelnspyvy
    eldvskeehfkslynsvkkdlgsldfivhsvafapkealegslletsksafntameisvy
    slieltntlkpllnngasvltlsylgstkymahynvmglakaalesavrylavdlgkhhi
    rvnalsagpirtlassgiadfrmilkwneinaplrknvsleevgnagmyllsslssgvsg
    evhfvdagyhvmgmgaveekdnkatllwdlhkeq
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >1jw7B (B:)
    mgflkgkkglivgvannksiaygiaqscfnqgatlaftylneslekrvrpiaqelnspyv
    yeldvskeehfkslynsvkkdlgsldfivhsvafapkealegslletsksafntameisv
    yslieltntlkpllnngasvltlsylgstkymahynvmglakaalesavrylavdlgkhh
    irvnalsagpirtlassgiadfrmilkwneinaplrknvsleevgnagmyllsslssgvs
    gevhfvdagyhvmgmgaveekdnkatllwdlhkeq
    

    Sequence, based on observed residues (ATOM records): (download)
    >1jw7B (B:)
    gflkgkkglivgvannksiaygiaqscfnqgatlaftylneslekrvrpiaqelnspyvy
    eldvskeehfkslynsvkkdlgsldfivhsvafapkealegslletsksafntameisvy
    slieltntlkpllnngasvltlsylgstkymahynvmglakaalesavrylavdlgkhhi
    rvnalsagpirtlassgiadfrmilkwneinaplrknvsleevgnagmyllsslssgvsg
    evhfvdagyhvmgmgaveekdnkatllwdlhkeq
    

  • Chain 'C':
    Sequence, based on SEQRES records: (download)
    >1jw7C (C:)
    mgflkgkkglivgvannksiaygiaqscfnqgatlaftylneslekrvrpiaqelnspyv
    yeldvskeehfkslynsvkkdlgsldfivhsvafapkealegslletsksafntameisv
    yslieltntlkpllnngasvltlsylgstkymahynvmglakaalesavrylavdlgkhh
    irvnalsagpirtlassgiadfrmilkwneinaplrknvsleevgnagmyllsslssgvs
    gevhfvdagyhvmgmgaveekdnkatllwdlhkeq
    

    Sequence, based on observed residues (ATOM records): (download)
    >1jw7C (C:)
    gflkgkkglivgvannksiaygiaqscfnqgatlaftylneslekrvrpiaqelnspyvy
    eldvskeehfkslynsvkkdlgsldfivhsvafapkealegslletsksafntameisvy
    slieltntlkpllnngasvltlsylgstkymahynvmglakaalesavrylavdlgkhhi
    rvnalsagpirtlassgiadfrmilkwneinaplrknvsleevgnagmyllsslssgvsg
    evhfvdagyhvmgmgaveekdnkatllwdlhkeq
    

  • Chain 'D':
    Sequence, based on SEQRES records: (download)
    >1jw7D (D:)
    mgflkgkkglivgvannksiaygiaqscfnqgatlaftylneslekrvrpiaqelnspyv
    yeldvskeehfkslynsvkkdlgsldfivhsvafapkealegslletsksafntameisv
    yslieltntlkpllnngasvltlsylgstkymahynvmglakaalesavrylavdlgkhh
    irvnalsagpirtlassgiadfrmilkwneinaplrknvsleevgnagmyllsslssgvs
    gevhfvdagyhvmgmgaveekdnkatllwdlhkeq
    

    Sequence, based on observed residues (ATOM records): (download)
    >1jw7D (D:)
    gflkgkkglivgvannksiaygiaqscfnqgatlaftylneslekrvrpiaqelnspyvy
    eldvskeehfkslynsvkkdlgsldfivhsvafapkealegslletsksafntameisvy
    slieltntlkpllnngasvltlsylgstkymahynvmglakaalesavrylavdlgkhhi
    rvnalsagpirtlassgiadfrmilkwneinaplrknvsleevgnagmyllsslssgvsg
    evhfvdagyhvmgmgaveekdnkatllwdlhkeq