PDB entry 1jw6

View 1jw6 on RCSB PDB site
Description: Crystal Structure of the Complex of Concanavalin A and Hexapeptide
Class: sugar binding protein
Keywords: Complex with Hexapeptide
Deposited on 2001-09-02, released 2001-09-26
The last revision prior to the SCOP 1.75 freeze date was dated 2003-09-30, with a file datestamp of 2007-06-04.
Experiment type: XRAY
Resolution: 1.93 Å
R-factor: 0.19
AEROSPACI score: 0.51 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: concanavalin a
    Species: Canavalia ensiformis
    Database cross-references and differences (RAF-indexed):
    • Uniprot P02866 (118-236)
      • see remark 999 (150)
      • see remark 999 (154)
    Domains in SCOP 1.75: d1jw6a_
  • Chain 'B':
    Compound: protein (6-mer)
    Species: synthetic, synthetic
  • Heterogens: MN, CA, PTD, IPA, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1jw6A (A:)
    adtivaveldtypntdigdpsyphigidiksvrskktakwnmqngkvgtahiiynsvdkr
    lsavvsypnadsatvsydvdldnvlpewvrvglsastglyketntilswsftsklksnst
    hetnalhfmfnqfskdqkdlilqgdattgtdgnleltrvssngspqgssvgralfyapvh
    iwessavvasfeatftflikspdshpadgiaffisnidssipsgstgrllglfpdan
    

  • Chain 'B':
    No sequence available.