PDB entry 1jvs

View 1jvs on RCSB PDB site
Description: Crystal structure of 1-deoxy-D-xylulose 5-phosphate reductoisomerase; a target enzyme for antimalarial drugs
Class: oxidoreductase
Keywords: reductoisomerase, NADPH, OXIDOREDUCTASE
Deposited on 2001-08-31, released 2002-10-09
The last revision prior to the SCOPe 2.07 freeze date was dated 2017-10-04, with a file datestamp of 2017-09-29.
Experiment type: XRAY
Resolution: 2.2 Å
R-factor: N/A
AEROSPACI score: 0.26 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: 1-deoxy-D-xylulose 5-phosphate reductoisomerase
    Species: Escherichia coli [TaxId:562]
    Database cross-references and differences (RAF-indexed):
    • Uniprot P45568 (1-397)
      • cloning artifact (0)
      • modified residue (41)
      • modified residue (55)
      • modified residue (67)
      • modified residue (87)
      • modified residue (97)
      • modified residue (135)
      • modified residue (200)
      • modified residue (213)
      • modified residue (224-225)
      • modified residue (245)
      • modified residue (258)
      • modified residue (275)
      • modified residue (283)
      • modified residue (321)
      • modified residue (366)
      • modified residue (368)
      • modified residue (393)
      • cloning artifact (398-399)
    Domains in SCOPe 2.07: d1jvsa1, d1jvsa2, d1jvsa3, d1jvsa4, d1jvsa5
  • Chain 'B':
    Compound: 1-deoxy-D-xylulose 5-phosphate reductoisomerase
    Species: Escherichia coli [TaxId:562]
    Database cross-references and differences (RAF-indexed):
    • Uniprot P45568 (1-397)
      • cloning artifact (0)
      • modified residue (41)
      • modified residue (55)
      • modified residue (67)
      • modified residue (87)
      • modified residue (97)
      • modified residue (135)
      • modified residue (200)
      • modified residue (213)
      • modified residue (224-225)
      • modified residue (245)
      • modified residue (258)
      • modified residue (275)
      • modified residue (283)
      • modified residue (321)
      • modified residue (366)
      • modified residue (368)
      • modified residue (393)
    Domains in SCOPe 2.07: d1jvsb1, d1jvsb2, d1jvsb3, d1jvsb4
  • Heterogens: SO4, NDP, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1jvsA (A:)
    gkqltilgstgsigcstldvvrhnpehfrvvalvagknvtrmveqclefspryavmddea
    sakllktmlqqqgsrtevlsgqqaacdmaaledvdqvmaaivgaagllptlaairagkti
    llankeslvtcgrlfmdavkqskaqllpvdsehnaifqslpqpiqhnlgyadleqngvvs
    illtgsggpfretplrdlatmtpdqacrhpnwsmgrkisvdsatmmnkgleyiearwlfn
    asasqmevlihpqsvihsmvryqdgsvlaqlgepdmrtpiahtmawpnrvnsgvkpldfc
    klsaltfaapdydrypclklameafeqgqaattalnaaneitvaaflaqqirftdiaaln
    lsvlekmdmrepqcvddvlsvdanarevarkevmrlassa
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >1jvsB (B:)
    gkqltilgstgsigcstldvvrhnpehfrvvalvagknvtrmveqclefspryavmddea
    sakllktmlqqqgsrtevlsgqqaacdmaaledvdqvmaaivgaagllptlaairagkti
    llankeslvtcgrlfmdavkqskaqllpvdsehnaifqslpqpiqhnlgyadleqngvvs
    illtgsggpfretplrdlatmtpdqacrhpnwsmgrkisvdsatmmnkgleyiearwlfn
    asasqmevlihpqsvihsmvryqdgsvlaqlgepdmrtpiahtmawpnrvnsgvkpldfc
    klsaltfaapdydrypclklameafeqgqaattalnaaneitvaaflaqqirftdiaaln
    lsvlekmdmrepqcvddvlsvdanarevarkevmrlassa
    

    Sequence, based on observed residues (ATOM records): (download)
    >1jvsB (B:)
    gkqltilgstgsigcstldvvrhnpehfrvvalvagknvtrmveqclefspryavmddea
    sakllktmlqqqgsrtevlsgqqaacdmaaledvdqvmaaivgaagllptlaairagkti
    llankeslvtcgrlfmdavkqskaqllpvdsehnaifqslpqpiqhnlgyadleqngvvs
    illtgsggpfretplrdlatmtpdqacrhpnwsmgrkisvdsatmmnkgleyiearwlfn
    asasqmevlihpqsvihsmvryqdgsvlaqlgepdmrtpiahtmawpnrvnsgvkpldfc
    klsaltfaapdydrypclklameafeqgqaattalnaaneitvaaflaqqirftdiaaln
    lsvlekmdmrepqcvddvlsvdanarevarkevmrlas