PDB entry 1jvo

View 1jvo on RCSB PDB site
Description: Azurin dimer, crosslinked via disulfide bridge
Class: electron transport
Keywords: cupredoxin, electron transfer, covalent crosslink, ELECTRON TRANSPORT
Deposited on 2001-08-30, released 2002-01-04
The last revision prior to the SCOPe 2.07 freeze date was dated 2009-02-24, with a file datestamp of 2009-03-01.
Experiment type: XRAY
Resolution: 2.75 Å
R-factor: 0.244
AEROSPACI score: 0.24 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Azurin
    Species: Pseudomonas aeruginosa [TaxId:287]
    Gene: AZU
    Database cross-references and differences (RAF-indexed):
    • Uniprot P00282 (0-127)
      • engineered (41)
    Domains in SCOPe 2.07: d1jvoa_
  • Chain 'B':
    Compound: Azurin
    Species: Pseudomonas aeruginosa [TaxId:287]
    Gene: AZU
    Database cross-references and differences (RAF-indexed):
    • Uniprot P00282 (0-127)
      • engineered (41)
    Domains in SCOPe 2.07: d1jvob_
  • Chain 'C':
    Compound: Azurin
    Species: Pseudomonas aeruginosa [TaxId:287]
    Gene: AZU
    Database cross-references and differences (RAF-indexed):
    • Uniprot P00282 (0-127)
      • engineered (41)
    Domains in SCOPe 2.07: d1jvoc_
  • Chain 'D':
    Compound: Azurin
    Species: Pseudomonas aeruginosa [TaxId:287]
    Gene: AZU
    Database cross-references and differences (RAF-indexed):
    • Uniprot P00282 (0-127)
      • engineered (41)
    Domains in SCOPe 2.07: d1jvod_
  • Chain 'E':
    Compound: Azurin
    Species: Pseudomonas aeruginosa [TaxId:287]
    Gene: AZU
    Database cross-references and differences (RAF-indexed):
    • Uniprot P00282 (0-127)
      • engineered (41)
    Domains in SCOPe 2.07: d1jvoe_
  • Chain 'F':
    Compound: Azurin
    Species: Pseudomonas aeruginosa [TaxId:287]
    Gene: AZU
    Database cross-references and differences (RAF-indexed):
    • Uniprot P00282 (0-127)
      • engineered (41)
    Domains in SCOPe 2.07: d1jvof_
  • Chain 'G':
    Compound: Azurin
    Species: Pseudomonas aeruginosa [TaxId:287]
    Gene: AZU
    Database cross-references and differences (RAF-indexed):
    • Uniprot P00282 (0-127)
      • engineered (41)
    Domains in SCOPe 2.07: d1jvog_
  • Chain 'H':
    Compound: Azurin
    Species: Pseudomonas aeruginosa [TaxId:287]
    Gene: AZU
    Database cross-references and differences (RAF-indexed):
    • Uniprot P00282 (0-127)
      • engineered (41)
    Domains in SCOPe 2.07: d1jvoh_
  • Chain 'I':
    Compound: Azurin
    Species: Pseudomonas aeruginosa [TaxId:287]
    Gene: AZU
    Database cross-references and differences (RAF-indexed):
    • Uniprot P00282 (0-127)
      • engineered (41)
    Domains in SCOPe 2.07: d1jvoi_
  • Chain 'J':
    Compound: Azurin
    Species: Pseudomonas aeruginosa [TaxId:287]
    Gene: AZU
    Database cross-references and differences (RAF-indexed):
    • Uniprot P00282 (0-127)
      • engineered (41)
    Domains in SCOPe 2.07: d1jvoj_
  • Chain 'K':
    Compound: Azurin
    Species: Pseudomonas aeruginosa [TaxId:287]
    Gene: AZU
    Database cross-references and differences (RAF-indexed):
    • Uniprot P00282 (0-127)
      • engineered (41)
    Domains in SCOPe 2.07: d1jvok_
  • Chain 'L':
    Compound: Azurin
    Species: Pseudomonas aeruginosa [TaxId:287]
    Gene: AZU
    Database cross-references and differences (RAF-indexed):
    • Uniprot P00282 (0-127)
      • engineered (41)
    Domains in SCOPe 2.07: d1jvol_
  • Heterogens: CU

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1jvoA (A:)
    aecsvdiqgndqmqfntnaitvdksckqftvnlshpgnlpkcvmghnwvlstaadmqgvv
    tdgmasgldkdylkpddsrviahtkligsgekdsvtfdvsklkegeqymffctfpghsal
    mkgtltlk
    

  • Chain 'B':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1jvoB (B:)
    aecsvdiqgndqmqfntnaitvdksckqftvnlshpgnlpkcvmghnwvlstaadmqgvv
    tdgmasgldkdylkpddsrviahtkligsgekdsvtfdvsklkegeqymffctfpghsal
    mkgtltlk
    

  • Chain 'C':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1jvoC (C:)
    aecsvdiqgndqmqfntnaitvdksckqftvnlshpgnlpkcvmghnwvlstaadmqgvv
    tdgmasgldkdylkpddsrviahtkligsgekdsvtfdvsklkegeqymffctfpghsal
    mkgtltlk
    

  • Chain 'D':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1jvoD (D:)
    aecsvdiqgndqmqfntnaitvdksckqftvnlshpgnlpkcvmghnwvlstaadmqgvv
    tdgmasgldkdylkpddsrviahtkligsgekdsvtfdvsklkegeqymffctfpghsal
    mkgtltlk
    

  • Chain 'E':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1jvoE (E:)
    aecsvdiqgndqmqfntnaitvdksckqftvnlshpgnlpkcvmghnwvlstaadmqgvv
    tdgmasgldkdylkpddsrviahtkligsgekdsvtfdvsklkegeqymffctfpghsal
    mkgtltlk
    

  • Chain 'F':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1jvoF (F:)
    aecsvdiqgndqmqfntnaitvdksckqftvnlshpgnlpkcvmghnwvlstaadmqgvv
    tdgmasgldkdylkpddsrviahtkligsgekdsvtfdvsklkegeqymffctfpghsal
    mkgtltlk
    

  • Chain 'G':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1jvoG (G:)
    aecsvdiqgndqmqfntnaitvdksckqftvnlshpgnlpkcvmghnwvlstaadmqgvv
    tdgmasgldkdylkpddsrviahtkligsgekdsvtfdvsklkegeqymffctfpghsal
    mkgtltlk
    

  • Chain 'H':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1jvoH (H:)
    aecsvdiqgndqmqfntnaitvdksckqftvnlshpgnlpkcvmghnwvlstaadmqgvv
    tdgmasgldkdylkpddsrviahtkligsgekdsvtfdvsklkegeqymffctfpghsal
    mkgtltlk
    

  • Chain 'I':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1jvoI (I:)
    aecsvdiqgndqmqfntnaitvdksckqftvnlshpgnlpkcvmghnwvlstaadmqgvv
    tdgmasgldkdylkpddsrviahtkligsgekdsvtfdvsklkegeqymffctfpghsal
    mkgtltlk
    

  • Chain 'J':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1jvoJ (J:)
    aecsvdiqgndqmqfntnaitvdksckqftvnlshpgnlpkcvmghnwvlstaadmqgvv
    tdgmasgldkdylkpddsrviahtkligsgekdsvtfdvsklkegeqymffctfpghsal
    mkgtltlk
    

  • Chain 'K':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1jvoK (K:)
    aecsvdiqgndqmqfntnaitvdksckqftvnlshpgnlpkcvmghnwvlstaadmqgvv
    tdgmasgldkdylkpddsrviahtkligsgekdsvtfdvsklkegeqymffctfpghsal
    mkgtltlk
    

  • Chain 'L':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1jvoL (L:)
    aecsvdiqgndqmqfntnaitvdksckqftvnlshpgnlpkcvmghnwvlstaadmqgvv
    tdgmasgldkdylkpddsrviahtkligsgekdsvtfdvsklkegeqymffctfpghsal
    mkgtltlk