PDB entry 1jvm

View 1jvm on RCSB PDB site
Description: kcsa potassium channel with tba (tetrabutylammonium) and rubidium
Class: membrane protein
Keywords: membrane protein, potassium channel, metal transport
Deposited on 2001-08-30, released 2001-12-05
The last revision prior to the SCOPe 2.06 freeze date was dated 2009-02-24, with a file datestamp of 2009-03-01.
Experiment type: XRAY
Resolution: 2.8 Å
R-factor: 0.281
AEROSPACI score: 0.17 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Voltage-gated potassium channel
    Species: Streptomyces lividans [TaxId:1916]
    Database cross-references and differences (RAF-indexed):
    • Uniprot P0A334
      • engineered (89)
    Domains in SCOPe 2.06: d1jvma_
  • Chain 'B':
    Compound: Voltage-gated potassium channel
    Species: Streptomyces lividans [TaxId:1916]
    Database cross-references and differences (RAF-indexed):
    • Uniprot P0A334
      • engineered (89)
    Domains in SCOPe 2.06: d1jvmb_
  • Chain 'C':
    Compound: Voltage-gated potassium channel
    Species: Streptomyces lividans [TaxId:1916]
    Database cross-references and differences (RAF-indexed):
    • Uniprot P0A334
      • engineered (89)
    Domains in SCOPe 2.06: d1jvmc_
  • Chain 'D':
    Compound: Voltage-gated potassium channel
    Species: Streptomyces lividans [TaxId:1916]
    Database cross-references and differences (RAF-indexed):
    • Uniprot P0A334
      • engineered (89)
    Domains in SCOPe 2.06: d1jvmd_
  • Heterogens: RB, TBA, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >1jvmA (A:)
    mapmlsgllarlvklllgrhgsalhwraagaatvllvivllagsylavlaergapgaqli
    typralwwsvetattvgygdlypvtlwgrcvavvvmvagitsfglvtaalatwfvgreqe
    rrghf
    

    Sequence, based on observed residues (ATOM records): (download)
    >1jvmA (A:)
    lhwraagaatvllvivllagsylavlaergapgaqlitypralwwsvetattvgygdlyp
    vtlwgrcvavvvmvagitsfglvtaalatwfvgreqe
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >1jvmB (B:)
    mapmlsgllarlvklllgrhgsalhwraagaatvllvivllagsylavlaergapgaqli
    typralwwsvetattvgygdlypvtlwgrcvavvvmvagitsfglvtaalatwfvgreqe
    rrghf
    

    Sequence, based on observed residues (ATOM records): (download)
    >1jvmB (B:)
    lhwraagaatvllvivllagsylavlaergapgaqlitypralwwsvetattvgygdlyp
    vtlwgrcvavvvmvagitsfglvtaalatwfvgreqerrg
    

  • Chain 'C':
    Sequence, based on SEQRES records: (download)
    >1jvmC (C:)
    mapmlsgllarlvklllgrhgsalhwraagaatvllvivllagsylavlaergapgaqli
    typralwwsvetattvgygdlypvtlwgrcvavvvmvagitsfglvtaalatwfvgreqe
    rrghf
    

    Sequence, based on observed residues (ATOM records): (download)
    >1jvmC (C:)
    lhwraagaatvllvivllagsylavlaergapgaqlitypralwwsvetattvgygdlyp
    vtlwgrcvavvvmvagitsfglvtaalatwfvgreqe
    

  • Chain 'D':
    Sequence, based on SEQRES records: (download)
    >1jvmD (D:)
    mapmlsgllarlvklllgrhgsalhwraagaatvllvivllagsylavlaergapgaqli
    typralwwsvetattvgygdlypvtlwgrcvavvvmvagitsfglvtaalatwfvgreqe
    rrghf
    

    Sequence, based on observed residues (ATOM records): (download)
    >1jvmD (D:)
    lhwraagaatvllvivllagsylavlaergapgaqlitypralwwsvetattvgygdlyp
    vtlwgrcvavvvmvagitsfglvtaalatwfvgreqerrg